SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015312 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015312
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily DEATH domain 2.68e-23
Family Caspase recruitment domain, CARD 0.0000104
Further Details:      
 
Domain Number 2 Region: 110-192
Classification Level Classification E-value
Superfamily DEATH domain 2.35e-18
Family DEATH domain, DD 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015312   Gene: ENSCPOG00000024194   Transcript: ENSCPOT00000021566
Sequence length 199
Comment pep:known scaffold:cavPor3:scaffold_9:7514343:7689858:-1 gene:ENSCPOG00000024194 transcript:ENSCPOT00000021566 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEARDKQVLRSLRLELGAEVLVEGLVLQYLYQEGILTENHVQEIKAQTTGLRKTMLLLDI
LPSRGPKAFDTFLDSLQEFPWVREKLEKAREEAITELPKGDQVPGIPSHILNSSPSDQQI
NQLAQRLGAEWEHVVLSLGLSQTDVYRCKANHPHNVQSQVVEAFVRWRQRYGKQATFLSL
HKGLQAVEADPSVLQHVLE
Download sequence
Identical sequences A0A286XWV4
10141.ENSCPOP00000015312 ENSCPOP00000015312 ENSCPOP00000015312 XP_013014705.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]