SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015371 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015371
Domain Number 1 Region: 67-163
Classification Level Classification E-value
Superfamily PDZ domain-like 1.71e-17
Family PDZ domain 0.0000203
Further Details:      
 
Domain Number 2 Region: 1170-1235
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.57e-16
Family SAM (sterile alpha motif) domain 0.0000679
Further Details:      
 
Domain Number 3 Region: 2-34
Classification Level Classification E-value
Superfamily SH3-domain 0.00000016
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015371   Gene: ENSCPOG00000006983   Transcript: ENSCPOT00000025826
Sequence length 1238
Comment pep:known scaffold:cavPor3:scaffold_184:141325:170034:-1 gene:ENSCPOG00000006983 transcript:ENSCPOT00000025826 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VLSIGEGGFWEGTVKGRTGWFPADCVEEVQMRQYDTRHETREDRTKRLFRHYTVGSYDSL
TSHSDYVIDDKVAVLQKRDHEGFGFVLRGAKAETPIEEFTPTPAFPALQYLESVDVEGVA
WRAGLRTGDFLIEVNGVNVVKVGHKQVVALIRQGGNRLVMKVVSVTRKPEEDGARRRAPP
PPKRAPSTTLTLRSKSMTAELEELASIRRRKGEKLDEILAAAAEPTLRPDIADADSRAAT
VKQRPTSRWITPAEISSLFERQGLPGPEKLPGSLRKGIPRTKSVGEDEKLASLLEGRFPR
SSSMQDSGREGRGIPPPPQTAPPPPPAPYYFDSGPPPAFSPPPPPGRAYDTVRSSFKPGL
EARLGAGAPGLYEPGALSPLAYPERQKRARSMIILQDSAPEASDVPRPTPAATPPERPKR
RPRPPGPDSPYANLGAFSASLFAPSKPQRRKSPLVKQLQVEDAQERAALAVGSPGPGGGS
FAREPSPTHRGPRPGGLDYGAGDGLGLAFGGPGSGPGPGPGPGKERRLEERRRSTVFLSV
GAIEGSSSSTDLPSLQPSRSIDERVLGTSATAGRDLLLPSPVSALKPLVSGPSLGPSGST
FIHPLTGKPLDPSSPLALALAARERALASQAPSRSPTPVHSPDADRPGPLFVDVQARDSE
RGALASPAFSPRSPAWIPVPARREAEKTPREERKSPEDKKSMILSVLDTSLQRPAGLIVV
HATSNGQEPSRLGAEEERPGTPELAPASMQTAAVSEPLPSPRAQPPGSAPSDSGPGQGSS
EEEPELVFAVNLPPAQLSSSDEETREELARIGLVPPPEEFANGILLATPLPGPGPLPTTV
PSPASGKPSSEPPPAPESAADSGVEEADTRSSSDPHLETTSTISTVSSMSTLSSESGELT
DTHTSFADGHTFLLEKPPVPPKPKLKSPLGKGPVTFRDPLLKQSSDSELMAQQHHAASAG
LASAAGPARPRYLFQRRSKLWGDPVESRGLPGPEDDKPTVISELSSRLQQLNKDTRSLGE
EPVGGLGGLLDPAKKSPIAAARLFSSLSELSTISAQRSPGGPGAGASYSVRPGGRYPVAR
RAPSPVKPASLERVEGLGAGTGGAGRPFSLTPPTILKSSSLSIPHEPKEVRFVVRSVSAR
SRSPSPSPLPSPAPGPGPGASGPRRPFQQKPLQLWSKFDVGDWLESIHLGEHRDRFEDHE
IEGAHLPALTKDDFVELGVTRVGHRMNIERALRQLDGS
Download sequence
Identical sequences 10141.ENSCPOP00000015371 ENSCPOP00000015371 ENSCPOP00000015371

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]