SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015443 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015443
Domain Number 1 Region: 139-222
Classification Level Classification E-value
Superfamily DEATH domain 5.76e-16
Family DEATH domain, DD 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015443   Gene: ENSCPOG00000026310   Transcript: ENSCPOT00000026798
Sequence length 231
Comment pep:known scaffold:cavPor3:scaffold_7:47601788:47603213:1 gene:ENSCPOG00000026310 transcript:ENSCPOT00000026798 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYNSSHSRGVASVDNALKGQDRDREGVWTRAGGALAPNTSFSFPPEPPGASGSIIPVYC
ALLATVVLGLLGYVAFKCWRSHQQRQQLAKARTAELGALSRDQRLGDSSVFMDLPSGLES
CVSSQGPHTDLGCRLYLHLLRQQQEEVERLLEVSVEPDKGWRGLAARLGYQANAVETMAL
GQVPAYNLLRDWATQEGNRATLSVLQDALAAMGREDVIHVLGTPGEGYSVV
Download sequence
Identical sequences A0A286XVI8
ENSCPOP00000015443 XP_003476948.2.53824 ENSCPOP00000015443 10141.ENSCPOP00000015443

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]