SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015467 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015467
Domain Number 1 Region: 185-334
Classification Level Classification E-value
Superfamily Retrovirus capsid protein, N-terminal core domain 6.67e-27
Family Retrovirus capsid protein, N-terminal core domain 0.0077
Further Details:      
 
Domain Number 2 Region: 340-419
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 5.31e-18
Family Retrovirus capsid protein C-terminal domain 0.0019
Further Details:      
 
Domain Number 3 Region: 1-88
Classification Level Classification E-value
Superfamily Retroviral matrix proteins 4.12e-16
Family Mason-Pfizer monkey virus matrix protein 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015467   Gene: ENSCPOG00000024903   Transcript: ENSCPOT00000023244
Sequence length 422
Comment pep:novel scaffold:cavPor3:scaffold_2221:651:2007:1 gene:ENSCPOG00000024903 transcript:ENSCPOT00000023244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQSFSSPFLKILKHLLSMYGISLRSADLDMCVHTIKEYNPWLPDEGTLDVELWRRARAN
IEKAMRQDEKISLCFSAIWSVVYSLLKAMEDEHIVENFQQEIKPVIQELPLTEEEQTIVQ
NDAITLTSEKAAKLKTVQCLTQAVEQLSIKQSLPICPSAPPPSNPDWKNAKLALADMPGT
GDSGDDETSVFAFPVITPQPVDGVWEGFNMDDLTKLKKAVTLYGPQAHYTRELLMAVADQ
YGNLAPYDWKTLAKILLKVPEYLQWHMWFMEGCAEKARQNAEDRDPNVRLISYPMLSGTG
FYDTVEHQAAAPREIHAQLRNIALEAWDKMRPQGSEYGSRAKVLQRSNEPYVEFISRLQN
IIEKTVVGKDLQQHLLKLLAFENASDECKKVLIPIKDTGTIDNFIKQCKDLNSESKKMQL
FA
Download sequence
Identical sequences ENSCPOP00000015467 ENSCPOP00000015467 10141.ENSCPOP00000015467

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]