SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015488 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015488
Domain Number 1 Region: 322-444
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.44e-33
Family Calponin-homology domain, CH-domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015488   Gene: ENSCPOG00000027240   Transcript: ENSCPOT00000028347
Sequence length 447
Comment pep:known scaffold:cavPor3:scaffold_32:17627277:17647658:-1 gene:ENSCPOG00000027240 transcript:ENSCPOT00000028347 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPTLDAEEARTVREALGRYEAALEGAVRALHEDMQGLQREVERRVAEALNLAGPLGRTV
ADLQRDQRLQAQLERLTRQVEGAGAWEQGTRARGSEPRRPRLGPRTLFQAHAPSRCSGRS
QSVDHDEASEPEMRRTSNSGIVENGHQPGLCPGDGPTEGAQTSAPEPPKPRPVSLPLQLP
HQPVTAVTRVSEKFSGETSVAALSPTSAAILGGFSPSTKEDTTPWASSTTEKNSSFTRSL
PIAGYRGVTAGKCKDSPPLVTPPQSPLSPQLPATAPAPHQGERRRELVRSQTLPRTSGAQ
ARKALFEKWEQDTAGKGKGEARAKLKRSQSFGVASASSIKQILLEWCRSKTLGYQHVDLQ
NFSSSWSDGMAFCALVHSFFPDAFDYNALSPTQRQKNFELAFTMAENLANCERLIEVEDM
MVMGRKPDPMCVFTYVQSLYNHLRHFE
Download sequence
Identical sequences 10141.ENSCPOP00000015488 ENSCPOP00000015488 ENSCPOP00000015488

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]