SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000015797 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000015797
Domain Number 1 Region: 42-145
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000004
Family I set domains 0.062
Further Details:      
 
Domain Number 2 Region: 141-224
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000244
Family C1 set domains (antibody constant domain-like) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000015797   Gene: ENSCPOG00000026067   Transcript: ENSCPOT00000023498
Sequence length 226
Comment pep:known scaffold:cavPor3:scaffold_35:14376116:14382839:-1 gene:ENSCPOG00000026067 transcript:ENSCPOT00000023498 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TLAVRLLISIIIFMPDSGTSCMDEKQIIQNNSSPLAEANFRLSVEMGSTTVLCCPDVLLT
NVLLTTWKITLRGQPLCTKSYDKEENQTSDNCTDERITWAFRPDLSPHLQINGAAVTHDG
IYICEMVNSTGNFQHEFQLQVLVRPEANIFLNKNKTVVCQAVAGKPAAQISWIPPGHCQK
EETTSYSNRTVTVRSSCSYSGNVSTVTCLVSHLTGNWSLSESLSPG
Download sequence
Identical sequences ENSCPOP00000015797 10141.ENSCPOP00000015797 ENSCPOP00000015797

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]