SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016040 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016040
Domain Number 1 Region: 808-888
Classification Level Classification E-value
Superfamily DEATH domain 8.24e-20
Family DEATH domain, DD 0.00016
Further Details:      
 
Domain Number 2 Region: 241-291
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000876
Family TSP-1 type 1 repeat 0.00046
Further Details:      
 
Domain Number 3 Region: 151-242
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000236
Family I set domains 0.025
Further Details:      
 
Domain Number 4 Region: 295-349
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000144
Family TSP-1 type 1 repeat 0.00058
Further Details:      
 
Domain Number 5 Region: 44-146
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000014
Family I set domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016040   Gene: ENSCPOG00000023925   Transcript: ENSCPOT00000026970
Sequence length 898
Comment pep:known scaffold:cavPor3:scaffold_17:22550687:22609455:1 gene:ENSCPOG00000023925 transcript:ENSCPOT00000026970 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAVWPGLWPALLGIVLAAWLRGSDAQQSATVANPVPGANPDLLPHFLVEPEDVYIVKNKP
VLLVCKAVPATQIFFKCNGEWVRQVDHVIERSTDGSSGLPAMEVRINVSRQQVEKVFGLE
EYWCQCVAWSSSGTTKSQKAYIRIAYLRKNFEQEPLAKEVSLEQGIVLPCRPPEGIPPAE
VEWLRNEDLVDPSLDPNVYITREHSLVVRQARLADTANYTCVAKNIVARRRSASAAVIVY
VNGGWSTWTEWSVCSASCGRGWQKRSRSCTNPAPLNGGAFCEGQNVQKTACATLCPVDGS
WSPWSKWSACGLDCTHWRSRECSDPAPRNGGEECRGTDLDTRNCTSDLCVHTASGPEDVA
LYVGLIAVAVCLVLLLLVLILVYCRKKEGLDSDVADSSILTSGFQPVSIKPSKADNPHLL
TIQPDLSTTTTTYQGSLCPRQDGPSPKFQLTNGHLLSPLGSGRHTLHHSSPTSEAEDFVS
RLSTQNYFRSLPRGTSNMAYGTFNFLGGRLMIPNTGISLLIPPDAIPRGKIYEIYLTLHK
PEDVRLPLAGCQTLLSPIVSCGPPGVLLTRPVILAMDHCGEPNPESWSLCLKKQSCEGSW
EDVLHLGEEAPSHLYYCQLEASACYIFTEQLGRFALVGEALSVAAAKRLKLLLFAPVACT
SLEYNIRVYCLHDTHDALKEVVQLEKQLGGQLIQEPRVLHFKDSYHNLRLSIHDVPSSLW
KSKLLVSYQEIPFYHIWNGTQQYLHCTFTLERVSSSTSDLACKVWVWQVEGDGQSFNINF
NITKDTRFAELLALESEGGVPALVGPSAFKIPFLIRQKIITSLDPPCSRGADWRTLAQKL
HLDSHLSFFASKPSPTAMILNLWEARHFPNGNLSQLAAAVAGLGQPDAGLFTVSEAEC
Download sequence
Identical sequences H0VZA8
10141.ENSCPOP00000016040 ENSCPOP00000016040 XP_003473283.1.53824 ENSCPOP00000016040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]