SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016184 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000016184
Domain Number - Region: 38-91
Classification Level Classification E-value
Superfamily FnI-like domain 0.00209
Family Fibronectin type I module 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016184   Gene: ENSCPOG00000021717   Transcript: ENSCPOT00000026927
Sequence length 139
Comment pep:known scaffold:cavPor3:scaffold_27:16110880:16111887:-1 gene:ENSCPOG00000021717 transcript:ENSCPOT00000026927 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLRMLWATEAKGTLGGWGVICLVLSLLLQCPGVHTKCYFQAQAPCHYEGKYFTLGESWL
REDCFHCTCLHPVGVGCCDTSQHPIDFPAECEVRREAGTCQFSLVQKSDPRLPCKSRGPD
LEWGSANTPVPGAPAPHSS
Download sequence
Identical sequences A0A286XI43
XP_003470909.1.53824 ENSCPOP00000016184 ENSCPOP00000016184 10141.ENSCPOP00000016184

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]