SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016285 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016285
Domain Number 1 Region: 1-416
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.92e-101
Family L-arabinose binding protein-like 0.00061
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000016285
Domain Number - Region: 424-471
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0824
Family TNF receptor-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016285   Gene: ENSCPOG00000020639   Transcript: ENSCPOT00000024651
Sequence length 764
Comment pep:novel scaffold:cavPor3:scaffold_6:22470519:22478921:1 gene:ENSCPOG00000020639 transcript:ENSCPOT00000024651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IEKINKNPHLLPNISLGYEFHNFPYSHWKMLESSLILLTGQSDIPNYSCRSVAVLTGTSW
AASAQVGTLLELYKFPQVTFGSFDPVLGDNGQFPSIYQAAPKDTSLVLAMVSLLLHFRWT
WVGLVIMEGHKGLQFLSDVTGEMDRNKICVAFVKMVSTHLVSYMAAAKEYIILTKETSQV
NVVIIYYDTDFLNDVNYYIEQNLLTGKVWVTNSQWHADMTGKSFILNSFHGTLIFSNHHE
EISDFKMFVQEVNPSKYPDDFYLTRFWFNNFHCSFSDADCSLKDCSPNASLVQLPASHFD
TTMTDWSHNVHNAVYAVAHALHEMLLQQAQMSLVENKKVTVFSPWQLNPILKNIQFKNPA
GDQVNLNDKSKVDGQYDILNFWNFPEGLRLKVKFGTFTPHVPQGQRLSLSDDMIEWATGI
TEMPHSVCSESCQHGFRKTSQEGKPACCFDCTPCPENEITNDTDMEHCVKCPDDKYATIQ
QDHCLQKSVTFLAHEDLIGKMLAGTALSLTVLTAAVLGLFVKHQDTPIVKANNRALSYTL
LISLTFCFLCSLLFIGRPNSATCILQQITFAVVFTVVVSTVLAKTITVVLAFKITAPGKR
MRQLLISGAPNYIIPICTLVQLTLCGVWMGTNPPYIDTDAHSEHGHIIILCNKGSLTAFY
CVLGYLGSLALLSFTVAFLVRNLPDTFNEAKFLTFSTLVFCSMWLTFLPIYHSSKGKVMV
AMEVFSILVSGAGFLGCIFAPKCYIILLRPERNSLHHFRDKTHS
Download sequence
Identical sequences ENSCPOP00000016285 ENSCPOP00000016285 10141.ENSCPOP00000016285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]