SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016303 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016303
Domain Number 1 Region: 33-108
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000000267
Family Growth factor receptor domain 0.004
Further Details:      
 
Domain Number 2 Region: 97-169
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000000286
Family Fibronectin type I module 0.018
Further Details:      
 
Domain Number 3 Region: 199-244
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000235
Family TSP-1 type 1 repeat 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016303   Gene: ENSCPOG00000019677   Transcript: ENSCPOT00000020486
Sequence length 351
Comment pep:known scaffold:cavPor3:scaffold_41:839860:841720:1 gene:ENSCPOG00000019677 transcript:ENSCPOT00000020486 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SHRITMSHVAAAAVVLLVALCSQLGSGQDCSAQCTQCASEPAPRCPLGVSLVLDGCGCCR
VCAKQLGELCTQLHPCDPHKGLSCDFGSASNRNIGVCTAQGGAPCVFGGKVYRSGDTFHS
SCKYQCTCLDGAVGCVPLCSMDVRLPSPDCPFPRRVKLPGKCCEEWVCDQPKDSTAVGPA
LAAYRLEDTFGPDPTMMRANCLVQTTEWSACSKTCGMGLSTRVTNDNAYCRLEKQSRLCM
VRPCEVDLEENIKKGKKCIRTPKISKPVKFELSGCTSMKTYRAKFCGVCTDGRCCTPHAT
TTLPVEFKCPDGEIMKKSMMFIKSCACHYNCPGDNDIFESLYYKKMYGDMA
Download sequence
Identical sequences 10141.ENSCPOP00000016303 ENSCPOP00000016303 ENSCPOP00000016303

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]