SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016327 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016327
Domain Number 1 Region: 2-47
Classification Level Classification E-value
Superfamily Kringle-like 3.14e-17
Family Fibronectin type II module 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016327   Gene: ENSCPOG00000024582   Transcript: ENSCPOT00000020673
Sequence length 47
Comment pep:known scaffold:cavPor3:scaffold_209:489740:489880:-1 gene:ENSCPOG00000024582 transcript:ENSCPOT00000020673 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADPPPCSFPFKFRGEMFYNCIKTGYVLNRTWCSLTDDYSKDKKWKQC
Download sequence
Identical sequences ENSCPOP00000016327 ENSCPOP00000016327 10141.ENSCPOP00000016327

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]