SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016360 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016360
Domain Number 1 Region: 56-500
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.57e-103
Family L-arabinose binding protein-like 0.0005
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000016360
Domain Number - Region: 510-545
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0424
Family TNF receptor-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016360   Gene: ENSCPOG00000019732   Transcript: ENSCPOT00000024419
Sequence length 799
Comment pep:novel scaffold:cavPor3:scaffold_42:15451583:15473433:-1 gene:ENSCPOG00000019732 transcript:ENSCPOT00000024419 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LRLLLLHFNYLVLKIYLRNYKPFLCLKMIDDNEIQSKLHKQCSYVFTITLGLLKKSHCYK
YMNVWLTPSNYQNYLAFTFAVEEINRNPHILPNVSLGYEFHNFIYSHWRILENSFLLVTG
QHEIPNYTCKKESKCAAVLTENPWDTSAQIGPLLKLYKFPQVYTGSFDPTLSESGQYPSL
HQVAQKDTFLAFAMVSLMLHFRWNWVGLLTTEGHKGFQFLSDVRTEMDRNRVCVAFVKIV
ASITVSYFSVMQKHDILTADTSSVNVVVIYYDTDSLNDVSYNIVQNLMTWKIWVTNSQWQ
ADLDGRNFILDSFHGVLVFSHHYEEISGFKNYVQEATPFKYPEDTYLFMYWYNNFHCSFS
ESDCALENCIPNASLAWLPSNRFDTTMSDRSYNIYNGVYAVAHALHAMLFAEEQGPSMRN
RQIENGSCEKLNPFLKNTQFSNSAGDQVNLNNRRKLDSEYDILNFWNFPEGLRLKVKVGT
FSSHAPHGQKMTLSEDIIEWSTGVTEIPLSVCSQSCSPGFRKSPQEGKAACCFDCIPCAN
SEITNETAAVLGLFVKHQDTAIVKANNRTLSYILLISLLSCFLCSLLFIGQPNTATCILQ
QTIFAVAFTVAVSTVLAKTITVVLAFKITAPAKRIRRFLVSGTPNFIIPICSLIQLTLYA
VWMSTNPPYIDTDAHSEHGHIIIVCNKGSLTAFYCVLGYLGSLALLSFTVAFLARNLPDT
FNEAKFLTFSMLVFCSVWVTFLPVYHSSKGKVMVAMEVFSILASAAGLLGCIFVPKCYII
LLRPERNSLTGIKKETSYH
Download sequence
Identical sequences 10141.ENSCPOP00000016360 ENSCPOP00000016360 ENSCPOP00000016360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]