SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016394 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016394
Domain Number 1 Region: 33-283
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 4.25e-93
Family Calponin-homology domain, CH-domain 0.00000302
Further Details:      
 
Domain Number 2 Region: 299-420
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-33
Family Spectrin repeat 0.0000942
Further Details:      
 
Domain Number 3 Region: 2182-2296
Classification Level Classification E-value
Superfamily PH domain-like 2.03e-33
Family Pleckstrin-homology domain (PH domain) 0.0000189
Further Details:      
 
Domain Number 4 Region: 1533-1684
Classification Level Classification E-value
Superfamily Spectrin repeat 3.57e-29
Family Spectrin repeat 0.0017
Further Details:      
 
Domain Number 5 Region: 1647-1794
Classification Level Classification E-value
Superfamily Spectrin repeat 1.8e-27
Family Spectrin repeat 0.0008
Further Details:      
 
Domain Number 6 Region: 643-746
Classification Level Classification E-value
Superfamily Spectrin repeat 5.4e-26
Family Spectrin repeat 0.00026
Further Details:      
 
Domain Number 7 Region: 819-953
Classification Level Classification E-value
Superfamily Spectrin repeat 1.33e-25
Family Spectrin repeat 0.0031
Further Details:      
 
Domain Number 8 Region: 1013-1171
Classification Level Classification E-value
Superfamily Spectrin repeat 1.38e-25
Family Spectrin repeat 0.0000102
Further Details:      
 
Domain Number 9 Region: 1852-2006
Classification Level Classification E-value
Superfamily Spectrin repeat 4.05e-25
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 10 Region: 1235-1382
Classification Level Classification E-value
Superfamily Spectrin repeat 2.02e-23
Family Spectrin repeat 0.00086
Further Details:      
 
Domain Number 11 Region: 429-532
Classification Level Classification E-value
Superfamily Spectrin repeat 5.1e-22
Family Spectrin repeat 0.00039
Further Details:      
 
Domain Number 12 Region: 524-644
Classification Level Classification E-value
Superfamily Spectrin repeat 2.62e-19
Family Spectrin repeat 0.00069
Further Details:      
 
Domain Number 13 Region: 749-853
Classification Level Classification E-value
Superfamily Spectrin repeat 5.44e-19
Family Spectrin repeat 0.0015
Further Details:      
 
Domain Number 14 Region: 1979-2071
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000746
Family Spectrin repeat 0.0018
Further Details:      
 
Domain Number 15 Region: 1457-1546
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000475
Family Spectrin repeat 0.00084
Further Details:      
 
Domain Number 16 Region: 1396-1476
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000222
Family Spectrin repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000016394
Domain Number - Region: 1177-1265
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0288
Family Spectrin repeat 0.0000173
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016394   Gene: ENSCPOG00000025923   Transcript: ENSCPOT00000024524
Sequence length 2333
Comment pep:known scaffold:cavPor3:scaffold_20:9688967:9756444:-1 gene:ENSCPOG00000025923 transcript:ENSCPOT00000024524 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EPADMTSATEFENVGNQPPYSRINARWDAPDDELDNDNSSARLFERSRIKALADEREVVQ
KKTFTKWVNSHLARVSCRISDLYKDLRDGRMLIKLLEVLSGEMLPRPTKGKMRIHCLENV
DKALQFLKEQRVHLENMGSHDIVDGNHRLVLGLIWTIILRFQIQDIVVQTQEGRETRSAK
DALLLWCQMKTAGYPHVNVTNFTSSWKDGLAFNALIHKHRPDLIDFDKLKDSNARHNLEH
AFDVAERQLGIIPLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKVLAVEGKRVGKVIDH
AIETEKMIEKYSGLASDLLTWIEQTIVVLNSRKFANSLAGVQQQLQAFSTYRTVEKPPKF
QEKGNLEVLLFTIQSRMRANNQKVYTPHDGKLVSDINRAWESLEEAEYQRELALRSELIR
QEKLEQLARRFDRKAAMRETWLNENQRLVTQDNFGYDLAAVEAAKKKHEAIETDTAAYEE
RVKALEDLAQELEKENYHDQKRILARKDSILRLWSYLLELLRSRRQRLETTLELQKLFQD
MLHSIDWMDEIKAHLLSAEFGKHLLEAEDLLQKHKLMEADIAIQGDKVKAITAATLPFIE
STGYQPCDPQVIQDRVSHLQQCFEELSDMAAGRKAQLEQSKRLWKFFWEMDEAESWIKEK
EQIYSSMDYGKDLTSVLILQRKHKAFEDELRGLDTHLTQIFQEAEGMVARKQFGHPQIEA
RVKEVLAQWDQLKDLAAFRKNNLQDAENFFQFHGDADDLKAWLQDAHRLLSGEDVGQDEG
ATRALEKKHRDFLEELEESHSVMEHLEQQAQGFPEEFRDSPDVTNRLQALQELYQRVVAQ
ADLRRQRLQEALDLYTVFGESDACQLWMREKEKWLAQMDIPDTLEDLDVVQHRFDILDQE
MKTLKAQIDGVNLAANNLMESGHPRSREVKTYQDSLNTRWQAFQDLVSQRKNAVGSALRV
NNYCVDCEETSKWISDKTEVVKSIKDLGRDLAGIITIQRKLSGLERDVAAIQDRVGDLKR
ESQQLMESHPEQKDDIGQRYSNVEKLWEILQEALKDQEASLSEASKLQAFLQDLDEFQAW
LSMAQKAVASEDMPNSVLEAEQLLQQHSALKDEIDSHHENYQKIQASEASGEEATEAQKY
PEYQLLHQRLEGLGTGWDALRRMWESRGHCLRQCYGFQEFQRDAKQAEAILSNQEITLEH
EKPPESLAAAEAGIRKFEDFLLSMENNKDKVLSPVDSGNKLVDEGNLYSDKIKEKVQQIE
DRHQKNKQKAQEVSVLLKDNLELQHFLQNCQELTLWINDKLLTSLDVSYDETRNLHNKWL
KHQAFLAELASHQGWLENIDAEGKQLMEEKPWFKLRVAERLDALHRLWDELQDGTKKVTQ
VLSKARSSDLRSQTEADLNKWISAMEDQLRSDDLGKDLTSVNRMLAKLKRVEDQVNVRKQ
DLEEMFQSLEEDADLSVEKRFLDLLEPLGRRRKQLELSRAKLQISRDLEDETLWVEERLP
LAQSADYGTNLQTVQLFKKKNQTLQNEIQGHKPRVDDVLQRGEQLVVAAETDLQDIEERL
GHLQASWKTLQQAAAGRGQRLQDAHEAQQYYLDADEAEAWISEQELYIFSDEPPKDEEGA
IVMLKRHLRLQRTVEEYGRNIKQLASRAQGLLAAGHPEGEQIIRHQGQVDKQYAGLKDMA
EERRRKLENMYHLFQLKRETDDLEQWILEKEKVAADQEMGQDFDHVTMLRDKFRDFARET
GTIGQERVDNVNAIIERLIDAGHSEAATIAEWKDGLNDMWADLLELIDTRMQLLAASYDL
HRYFYTGAEILVLIDEKHRELPEDVGLDASTAESFHRVHKAFEQELHLLAVQVQQFQDVA
ARLQTAYAGEKADAIQSKEQEVSAAWQALLDACAGRRTQLVDTADKFRFFSMIRDLLSWM
ESIIRQIETQEKPRDVSSVELLLKYHQGIKAEINTRAKNFNTCLELGESLLQRQHQASDE
IREKLQQMMAKRLEMDKKWEDRDDRLRMLLEVCQFSRDASVAEAWLIAQEPYLASRDYGH
TVDSVEKLIRRHEAFEKSTATWAERFAALEKPTTLELKEQRQSPERPTEEPGPQEEEGET
AGEAPQVYRATTTERTSPGELEQSWPHDLQPPPLPRQHEDRQQDKSIGDDGPATEPLSKV
LDTPLSEGDEPTTLPAQLDHGHSVQMEGYLGRKHDLEGPNKKASNRSWNNLYCVLRNSEL
TFYKDAKNLALGVPYHGEEPLALRHAICEVAANYKKKKHVFKLRLSNGSEWLFHGKDEEE
MLSWLQGVSTAINESQSIRVKAQSLPLPSITGPEVSLGKKDKEKRFSFFPKKK
Download sequence
Identical sequences ENSCPOP00000016394 10141.ENSCPOP00000016394 ENSCPOP00000016394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]