SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016492 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016492
Domain Number 1 Region: 333-410
Classification Level Classification E-value
Superfamily DEATH domain 8.75e-19
Family DEATH domain, DD 0.0014
Further Details:      
 
Domain Number 2 Region: 35-89
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000283
Family TNF receptor-like 0.0026
Further Details:      
 
Domain Number 3 Region: 98-148
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000385
Family TNF receptor-like 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016492   Gene: ENSCPOG00000019548   Transcript: ENSCPOT00000023592
Sequence length 417
Comment pep:known scaffold:cavPor3:scaffold_25:26183668:26187679:1 gene:ENSCPOG00000019548 transcript:ENSCPOT00000023592 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEPRPRGCAAAAGAAGLLLLLLLGVGVQGSTPGSRCDCAGDVQRRYGPFCCRGCPMGHYL
KARCTEHCGDSTCLPCPRGTFLARENHYNGHCTRCQACDEEAFQVALVNCSVVADTHCGC
PPGWLVDCSVKPCMASSPFRCLPCPDCKSPDHHTPVPCFGRDNGCGPCPPGFYEHSDDCV
SCPTSILGSCPEPCAAVCGWRPMFWVQVLVAGLLVPFLLGVTFIYLYWRCQPHKLVVPAD
KAGTDALTPSQVSHLSSPDSTHALLESPGNSGKVCTVQLAGNSWTLGSQEAPCQQVPQSW
DQLPSQVLGSPLAPPLSPAPPAGSPAAMLQPGPQLYDVMDAVPARRWKEFVRTLGLREAE
IEAVEVEIGRFRDQQYEMLKRWRQQQPAGLGAVYAALERMGLDGCAEDLRLRLQRGP
Download sequence
Identical sequences ENSCPOP00000016492 10141.ENSCPOP00000016492 ENSCPOP00000016492

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]