SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016521 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016521
Domain Number 1 Region: 6-83
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000236
Family Calponin-homology domain, CH-domain 0.0055
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000016521
Domain Number - Region: 197-232
Classification Level Classification E-value
Superfamily Trimerization domain of TRAF 0.0288
Family Trimerization domain of TRAF 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016521   Gene: ENSCPOG00000020793   Transcript: ENSCPOT00000022062
Sequence length 236
Comment pep:known scaffold:cavPor3:scaffold_8:20907863:20910406:1 gene:ENSCPOG00000020793 transcript:ENSCPOT00000022062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASSMDEEALHQLYLWVDNIPLSRPKRNLSRDFSDGVLIAEIIKFYFPKMVEMHNYVPAN
SLQQKLSNWGHLNRKVLNKLNISVPDDVMRKIAQCVPGVVELVLIPLRQRLEERQKRRKQ
GIGSLQDLGLQNSSDYMDVGLSQKARGEGAVDPQGGGQHRGTRQPAPQPPGYNQAQQSDP
SFVLQIAEKEQELLASQETVQVLQMKVRRLEHLLQLKNVRIEDLSRRLQQAERKQR
Download sequence
Identical sequences ENSCPOP00000016521 ENSCPOP00000016521 10141.ENSCPOP00000016521

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]