SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016699 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016699
Domain Number 1 Region: 37-87
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000108
Family TNF receptor-like 0.003
Further Details:      
 
Domain Number 2 Region: 110-169
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000196
Family TNF receptor-like 0.0017
Further Details:      
 
Domain Number 3 Region: 171-194
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000182
Family TNF receptor-like 0.0029
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000016699
Domain Number - Region: 205-261
Classification Level Classification E-value
Superfamily Cation efflux protein transmembrane domain-like 0.00759
Family Cation efflux protein transmembrane domain-like 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016699   Gene: ENSCPOG00000015245   Transcript: ENSCPOT00000027860
Sequence length 525
Comment pep:known scaffold:cavPor3:scaffold_14:3061087:3081028:-1 gene:ENSCPOG00000015245 transcript:ENSCPOT00000027860 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
CCPDLLKFSPCLTFLNVSSIKYLLQVTFQVTPPCVTDRQYKHAGRCCNKCEPGKYMSSKC
TTTSDSVCLPCGPDEYLDTWNEEDKCLLHKVCDTGKALVAVDPGNRTAPRRCACTAGYHW
SQDCECCRRNSECGPGFGAQHPLQLNMDTVCKPCLTGYFSDAFSSTDKCKPWTNCTVLGK
REEHRGTEKSDAVCSSSLPSRKLPRVSSNTEPRIYLPSVIILLLFVFVALVAAVIFGVYY
RKRGKTVTVANLWHWVNDACSRLSGNKESSGDSCNSVHLAASPQHEVCEGVFLLTLEEKI
SPDRCCLDGAGVFRGARAGAGPCAQGEEARTFSLVEIEGDPFRQIPTEDEYVDRPSQSPE
CSLLRTQPGSKSTPPFSEPLEVGENDSLSQCFTGTESVVDSESCNFTKPPYRTDCIPESP
EKYSPKEGGDGGGPRWAASASLAGDCTGCGDPPGEDHDALESSPKCGHLPQCACGIGLPT
EEAASRAEGGEAPQDGDDARLPGSSRGGPGSGSSSSDQPPVSGKL
Download sequence
Identical sequences 10141.ENSCPOP00000016699 ENSCPOP00000016699 ENSCPOP00000016699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]