SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016773 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016773
Domain Number 1 Region: 2-176
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.24e-30
Family L-arabinose binding protein-like 0.014
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000016773
Domain Number - Region: 185-217
Classification Level Classification E-value
Superfamily TNF receptor-like 0.073
Family TNF receptor-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016773   Gene: ENSCPOG00000019425   Transcript: ENSCPOT00000022369
Sequence length 218
Comment pep:novel scaffold:cavPor3:scaffold_1122:16339:18812:-1 gene:ENSCPOG00000019425 transcript:ENSCPOT00000022369 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NHHEEIPGLKILFKGIIPSRYPENYWFKNFHCLLSNSDCSLRSCPPNASLAWLPVNHFDT
AMSDVSYNKYKAVYAVAHAFHEMILHTAQIQSMNNGEEHPYTVCCNQHPFLKNIHFNSTT
GDQVNLDDKRKLETEYDIFNFRNFPEGLRLRVKVVKFSPHVPHGQHLCVSDHLIEWSTEV
TEIPQSVCSESCDPGFRKVTQEGKAACCFDCSPCSENE
Download sequence
Identical sequences ENSCPOP00000016773 10141.ENSCPOP00000016773 ENSCPOP00000016773

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]