SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000016921 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000016921
Domain Number 1 Region: 395-538
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 2.35e-17
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000016921   Gene: ENSCPOG00000022699   Transcript: ENSCPOT00000019933
Sequence length 539
Comment pep:known scaffold:cavPor3:scaffold_8:24180792:24183648:-1 gene:ENSCPOG00000022699 transcript:ENSCPOT00000019933 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATGRLGIGETLGALNAALGPGNPVWFKETHAQHLRVRDFLAPRRALEARFGEGQVPEHV
LHALTGLQGPGVAPVLRCAQTPAGLSLQLQRPVVFERVLSAVDSYATPDSLASQGLRILL
HCPALRCSPGALRLSQLRVVIVADHLARALRSQGVCVRLVPAVQDPHLSTFLQKLRVDWP
TSSERASSEILRNLVLSKLPTAHNQETLPPGVLGSLGLKELVEQQGYRAGYDPNLDKCLV
TEDLLCVLAELQEAVWCWPKGNYPGLARPPNDPHSCMVIHLVSCEEEFQQQKLDLLWWKL
DDQAPLRQKHLVCGPVKVAVAPRTLTALQYYELRHAQVCKASTVKHGDSRVQDPAWTEIL
EVLTVATIKFEMLSTAPQGQLLLSDSSISTKGTKSGIFVMYNCARLATLFEGYKRNVEQG
LYPTFPSVKSLDFSLLHDEGEWLLLFNSVLPFPHLLSQTAGLTCTSPGLHISARTETVCK
FLVQLSMDFSSYYNRVHILGEPRPHLFGQMFARLQLLRAIREVLHAGLALLGLPPLSHI
Download sequence
Identical sequences ENSCPOP00000016921 10141.ENSCPOP00000016921 ENSCPOP00000016921 XP_003476705.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]