SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017228 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017228
Domain Number 1 Region: 44-264
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.63e-58
Family Ankyrin repeat 0.00000999
Further Details:      
 
Domain Number 2 Region: 325-399
Classification Level Classification E-value
Superfamily DEATH domain 0.0000000000212
Family DEATH domain, DD 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017228   Gene: ENSCPOG00000021865   Transcript: ENSCPOT00000020004
Sequence length 456
Comment pep:novel scaffold:cavPor3:scaffold_11:12164596:12167084:-1 gene:ENSCPOG00000021865 transcript:ENSCPOT00000020004 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RDYSARLLGLARREARALLDYGVTADPRALLAGQRHLLTARDENGDTPLHLAIIHGQTAV
IEQIAHIIYHVQHLGVANLTNHLQQTPLHLAVITGQTGVVSFLLQVGADPALLDRHGDSA
MHLALRAGVGAPDLLRVLLQSGAPAMPQLLHMPDFEGLYPVHLAVRARSPECLDLLVDSG
ADVEAAERQGGRTALHLATEMEELGLVTHLVTKLHANVNARTFAGNTPLHLAAGLGSPTL
TRLLLKAGADIHAENEEPLCPLSSPPTSGSDSDSEGPERDARGSFQGHTPLDLTRSTKVK
TLLLNAAQTSSEPPNIPPSPAGPGLSLGETTLQNLEQLLDGPEAQGSWAELAERLGLRSL
VDTYRKTPSPSGSLLRSYKLAGGDLAGLLDALSAMGLDEGKLLRGPETRDKLPSTAEVKE
DSAYGSQSVEQEAETLGPLPEPPGGLCHGHPQPQVH
Download sequence
Identical sequences ENSCPOP00000017228 ENSCPOP00000017228 10141.ENSCPOP00000017228

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]