SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017427 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017427
Domain Number 1 Region: 125-458
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1.73e-94
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000324
Further Details:      
 
Domain Number 2 Region: 460-580
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 9.81e-30
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00023
Further Details:      
 
Domain Number 3 Region: 15-115
Classification Level Classification E-value
Superfamily Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.00000000968
Family Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017427   Gene: ENSCPOG00000025172   Transcript: ENSCPOT00000019489
Sequence length 580
Comment pep:known scaffold:cavPor3:scaffold_49:1280768:1338929:-1 gene:ENSCPOG00000025172 transcript:ENSCPOT00000019489 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KPCKWKRKCLLHLSRVLDLPPEKLIKSISAIPISKKEKIGVADFQLFVDSLLENRNDHSR
SDNQVQTKRLAEKLKCDTVVSEISTGPRTINFKINRELLTKAVLQQVIEDGSKYGLKSEL
FCGLPQRKVIVEFSSPNVAKKFHVGHLRSTIIGNFIANLKEALGHQVTRINYLGDWGMQF
GLLGTGFQLFGYEEKLQSNPLQHLFEVYVQVNKEAADDKNIAKLAHEFFQRLELGDMQAL
SLWQRFRDLSVQEYSQIYKRLGIYFDEYSGESFYREKYQEVLKLLDSKGLLQKTIQGTAV
VDLSGNGDPSSVCTVMRSDGTSLYVTRDLAAAIDRMDRYNFDTMIYVTDKGQQKHFQQLF
QMLKIMGYDWAERCQHVPFGVVQGMKTRRGDVTFLEDVLNEIRLKMLQNMASIKTTKELP
NPQETAERVGLAALIIQDFRGLLLSDYHFSWDRVFQSRGDTGVFLQYTHARLHSLEETFG
CGYLNDFNTACLQEPQSVSVLQHLLRFDEVLYRSSQDLQPRHIVSYLLTLSHLAAMAHKT
LQIKDSPPEVAAARLHLFKAVRYVLANGMRLLGITPVCRM
Download sequence
Identical sequences 10141.ENSCPOP00000017427 ENSCPOP00000017427 ENSCPOP00000017427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]