SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017465 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017465
Domain Number 1 Region: 2-99
Classification Level Classification E-value
Superfamily Immunoglobulin 7.48e-36
Family V set domains (antibody variable domain-like) 0.0000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017465   Gene: ENSCPOG00000027354   Transcript: ENSCPOT00000007853
Sequence length 109
Comment pep:known scaffold:cavPor3:scaffold_37:1233173:1233499:1 gene:ENSCPOG00000027354 transcript:ENSCPOT00000007853 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DIQMTQSQSSLSASLGDRVAITCKASHNINSYLAWYQQKQGKAPKLLIYAASNLASGVPS
RFSGSGSGTDYSLTISSVEAEDIATYYCQQLSDFPPTVIQAMTKTTRSR
Download sequence
Identical sequences ENSCPOP00000017465 ENSCPOP00000017465 10141.ENSCPOP00000017465

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]