SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000017664 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000017664
Domain Number 1 Region: 8-42
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000694
Family BAFF receptor-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017664   Gene: ENSCPOG00000025873   Transcript: ENSCPOT00000020865
Sequence length 184
Comment pep:known scaffold:cavPor3:scaffold_4:30891094:30894473:1 gene:ENSCPOG00000025873 transcript:ENSCPOT00000020865 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EFQMAHQCFQEEYFDSLLRACKPCHLRCSKFPPPPCQRYCNAGTAPSVKGTNAILWACLF
LSLIVSLAVFVLMFLLRKMNSEPLKDQFKNAESVLLDAAVNAGLDDSKTHDEIILPRSQG
YTVEECICEDCVKSKLKVDSDHFFPLPALEEGATILVTTKTNDYCKSLPATSSVMEIEKS
ICTK
Download sequence
Identical sequences ENSCPOP00000017664 10141.ENSCPOP00000017664 ENSCPOP00000017664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]