SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

  Home > Genomes > Cavia porcellus 69_3 > ENSCPOP00000017678

Domain assignment for ENSCPOP00000017678 from Cavia porcellus 69_3

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:  ENSCPOP00000017678
Domain Number 1 Region: 408-668
Classification Level Classification E-value
Superfamily YWTD domain 9.94e-39
Family YWTD domain 0.0000263
Further Details:      
 
Domain Number 2 Region: 358-403
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000148
Family EGF-type module 0.0036
Further Details:      
 
Domain Number 3 Region: 119-155
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000196
Family LDL receptor-like module 0.0008
Further Details:      
 
Domain Number 4 Region: 241-280
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000589
Family LDL receptor-like module 0.0018
Further Details:      
 
Domain Number 5 Region: 205-242
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000327
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 6 Region: 160-195
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000681
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 7 Region: 39-77
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000314
Family LDL receptor-like module 0.0014
Further Details:      
 
Domain Number 8 Region: 1-37
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.0000000602
Family LDL receptor-like module 0.0016
Further Details:      
 
Domain Number 9 Region: 85-116
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000127
Family LDL receptor-like module 0.0013
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000017678
Domain Number - Region: 671-708
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0013
Family EGF-type module 0.015
Further Details:      
 
Domain Number - Region: 329-365
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0129
Family EGF-type module 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000017678   Gene: ENSCPOG00000024741   Transcript: ENSCPOT00000026594
Sequence length 708
Comment pep:novel scaffold:cavPor3:scaffold_130:2347651:2359959:1 gene:ENSCPOG00000024741 transcript:ENSCPOT00000026594 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence 
CTGSSVPCREGKKCVSPESLCDGEQDCLDGSDEENCFQTCHRPGVFQCLDGSRCIEGKYR
CDGAHQCPDGSDEVACWKPPEDCSLRCDENTRCIPKSWLCDGNPDCSDKKDEQGCLHENC
STSEFRCKSGQCVSYSLHCDGNPDCLDRSDEEGCPSAWPLRCPVGEVKCRTSGECVLAEW
ICDHDLDCKDGSDEKVAHSSFRKIQKCHPQQWACASRDQCVPDFWHCDGERDCRDGSDEA
ACPPQKCRASEFQCGTSICLNFSLVCDGKQDCADSSDEGGRCQLSACSPGQCPQTCHSSP
VGPVSCFRCSWSREHSLLPCQLWVRLVAPWGCSSGSVSSHLRQVCTCEPGFQNHAGSCED
VDECQGSGGQPCSHTCVNTEGSYICTCHPGYSLEPDGHACKATGTEPILLVAIQSNLFLY
GLRSLKEDILTTIDKNLIIFSVDYDLVDQKVFWADFNAESIQWISMDTTRKGTVVKGIKS
HCIAVDWIGRNLYWTDGTAGQILAIPLTAVWRGKSEYTIVLDDDLTQPQSLALDPLNGLM
YWSEVGEEPQIEKAGMDGSSRKILIDQGLGRPTSIALDQLSWKIFWSDDKFHSIGSANLD
GTGIRMLQLTQIKNPFSVTVFEDEVFWSEMKTRTIQRVQKMTGKSRAVLIKRSGQPYGLK
VMHEVLQPRSLNPCLDTGCSHLCLLSPRSEGSCFCPVGSLLTDDGLNC
Download sequence
Identical sequences 10141.ENSCPOP00000017678 ENSCPOP00000017678 ENSCPOP00000017678

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]
Please cite: Gough, J., Karplus, K., Hughey, R. and Chothia, C. (2001). "Assignment of Homology to Genome Sequences using a Library of Hidden Markov Models that Represent all Proteins of Known Structure." J. Mol. Biol., 313(4), 903-919.

Please send feedback, comments or questions to superfamily@cs.bris.ac.uk or use the feedback form.

© Copyright 2013 The SUPERFAMILY authors and Julian Gough.