SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018079 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018079
Domain Number 1 Region: 1-125
Classification Level Classification E-value
Superfamily DEATH domain 1.58e-36
Family DEATH effector domain, DED 0.000000376
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018079   Gene: ENSCPOG00000025713   Transcript: ENSCPOT00000021355
Sequence length 130
Comment pep:known scaffold:cavPor3:scaffold_56:9769987:9771296:1 gene:ENSCPOG00000025713 transcript:ENSCPOT00000021355 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEYGTLLQDLTNNITLEDLEQLKSACKEDIPSEKSEEITTGSAWFSFLESHNKLDKDNL
SYIEHIFEISRRPDLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEI
IKLAPPPKKA
Download sequence
Identical sequences A0A0D9S3Q3 A0A1A6HDR2 A0A1S3GD05 A0A1U7R032 A0A1U7TGE5 A0A212CGG5 A0A286XB17 A0A287AC69 A0A2I3HKB1 A0A2J8VHI3 A0A2K5NRA4 A0A2K5S6H0 A0A2K5TS32 A0A2K6DKQ4 A0A2K6G774 A0A2K6LF81 A0A2K6Q677 A0A2K6T556 B1AKZ4 F7ICU5 G3H7Y4 G3RB66 G3TPM3 G5BWK6 H0X4N0 I0FW10 I3MA01 K7C224 L5MJH0 M3W179 Q0VCY8 Q15121 Q5R529 Q5U318 Q9Z297 S7P4G0 S9XMW7
NP_001013249.1.100692 NP_001013249.1.4139 NP_001068924.1.59421 NP_001068924.1.76553 NP_001127112.1.23681 NP_001185596.1.72884 NP_001231780.1.28591 NP_001231780.1.69978 NP_001284506.1.87134 NP_001284506.1.92137 NP_003759.1.87134 NP_003759.1.92137 XP_001504473.2.31192 XP_001928995.1.46622 XP_002760214.1.60252 XP_003258747.1.23891 XP_003258751.1.23891 XP_003415230.1.64505 XP_003466613.1.53824 XP_003795238.1.62490 XP_003811934.1.60992 XP_003999642.1.62641 XP_004002713.1.66739 XP_004027757.1.27298 XP_004284494.1.21590 XP_004390255.1.4749 XP_004407921.1.74151 XP_004442836.1.5094 XP_004448486.1.11602 XP_004589133.1.84141 XP_004688434.1.23501 XP_004858782.1.39548 XP_005078267.1.91757 XP_005339427.1.77405 XP_005339428.1.77405 XP_005368634.1.66349 XP_005400255.1.28644 XP_005541324.1.63531 XP_005857829.1.60319 XP_005903940.1.15283 XP_005981764.1.78601 XP_006060550.1.26621 XP_006096966.1.53796 XP_006173998.1.101512 XP_006215710.1.17985 XP_006711662.1.92137 XP_006750934.1.47382 XP_006752898.1.95426 XP_006990645.1.50099 XP_007092425.1.5354 XP_007092426.1.5354 XP_007129687.1.24612 XP_007171837.1.59432 XP_007171838.1.59432 XP_007459996.1.90284 XP_007974709.1.81039 XP_008056910.1.4292 XP_008262458.1.1745 XP_008518703.1.77740 XP_008839034.1.79516 XP_008839035.1.79516 XP_008839036.1.79516 XP_008962536.1.60992 XP_010346841.1.74449 XP_010359067.1.97406 XP_010593172.1.64505 XP_010593173.1.64505 XP_010614975.1.5607 XP_010845178.1.44457 XP_010953939.1.22495 XP_011371377.1.92234 XP_011371378.1.92234 XP_011768372.1.29376 XP_011768373.1.29376 XP_011813042.1.43180 XP_011813043.1.43180 XP_011813044.1.43180 XP_011825780.1.47321 XP_011825781.1.47321 XP_011825782.1.47321 XP_011923041.1.92194 XP_012013927.1.54773 XP_012305104.1.9421 XP_012517338.1.63892 XP_012584441.1.23501 XP_012604629.1.48125 XP_012604630.1.48125 XP_012604631.1.48125 XP_012886114.1.60039 XP_014402966.1.60319 XP_014652522.1.5094 XP_014703835.1.49734 XP_014931687.1.86478 XP_014968489.1.72884 XP_015104512.1.17985 XP_015347496.1.40921 XP_015347497.1.40921 XP_015994974.1.101085 XP_016070230.1.3490 XP_016785953.1.37143 XP_016785956.1.37143 XP_017359121.1.71028 XP_017359122.1.71028 XP_017359123.1.71028 XP_017720320.1.44346 XP_017821888.1.60252 XP_017901864.1.57651 XP_019288735.1.44245 XP_019288736.1.44245 XP_019505196.1.44202 XP_019505197.1.44202 XP_019571975.1.88060 XP_019571976.1.88060 XP_019677880.1.62641 XP_019843694.1.53367 XP_020740817.1.74333 XP_020740824.1.74333 XP_020740832.1.74333 XP_021506272.1.76796 XP_021537586.1.83697 ENSLAFP00000017358 10116.ENSRNOP00000009049 10141.ENSCPOP00000018079 9606.ENSP00000353660 9685.ENSFCAP00000003620 9823.ENSSSCP00000006812 9913.ENSBTAP00000007616 ENSBTAP00000007616 ENSP00000353660 ENSRNOP00000009049 ENSCPOP00000018079 ENSP00000353660 ENSGGOP00000024356 ENSPPYP00000000745 ENSFCAP00000003620 ENSPCAP00000006436 ENSFCAP00000003620 ENSBTAP00000007616 1n3kA ENSPPYP00000000745 ENSOGAP00000010166 1n3k_A ENSLAFP00000017358 ENSCJAP00000010971 ENSNLEP00000016374 ENSCPOP00000018079 ENSRNOP00000064962 ENSCJAP00000010971 ENSSTOP00000006768 ENSOGAP00000010166 gi|4505705|ref|NP_003759.1| 000003371|e1n3kA1|110.1.1.4|A:1-130 cath|current|1n3kA00/1-130 d1n3ka_ HGL_H00000357055 ENSSTOP00000006768 ENSPCAP00000006436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]