SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018084 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018084
Domain Number 1 Region: 26-78
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000628
Family TNF receptor-like 0.0026
Further Details:      
 
Domain Number 2 Region: 102-162
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000206
Family TNF receptor-like 0.0028
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000018084
Domain Number - Region: 198-253
Classification Level Classification E-value
Superfamily Mitochondrial cytochrome c oxidase subunit VIa 0.034
Family Mitochondrial cytochrome c oxidase subunit VIa 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018084   Gene: ENSCPOG00000023827   Transcript: ENSCPOT00000026345
Sequence length 282
Comment pep:known scaffold:cavPor3:scaffold_45:12576553:12584776:1 gene:ENSCPOG00000023827 transcript:ENSCPOT00000026345 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVRLALLCVLWGCLLTAVHPEASFACTENQFLLNDVCCDLCPPGKKLVDECTEFKNTECR
SCQKGEFLDTWNRERHCYVHRHCDPNVGLWVQKEGTAETDTTCVCEEGRHCTSDACEHCD
LHTSCGPGFGVKQLGTATSDTICEPCPNGFFSNVSSAFEKCHPWTSCENEYLVELRAGTN
RTDAVCGFQNRSRVLLVIPIVIGILIFIFLMSSVYFTGKVFRKPEVKAVSYKPERQLPVE
WPDGDDFLGHNTAAPVQETLHGCQPVTQEDGKESRISVQERL
Download sequence
Identical sequences 10141.ENSCPOP00000018084 ENSCPOP00000018084 ENSCPOP00000018084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]