SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018110 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSCPOP00000018110
Domain Number - Region: 59-108
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0153
Family TNF receptor-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018110   Gene: ENSCPOG00000024995   Transcript: ENSCPOT00000020413
Sequence length 226
Comment pep:known scaffold:cavPor3:scaffold_186:1131501:1133311:1 gene:ENSCPOG00000024995 transcript:ENSCPOT00000020413 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLRAALYGLVLLSVLSLGCCLTEGPCGPGRFLNGTGINSRCCSLHALGKAHTTRDCECI
QPEYHCADPECGTCKYHPCPPGTEVQPEGKLKYGFTCVSCAAGTFSQDRQGRCKPWADCG
QFGFLTMFPGNKTHNAVCLPGPLPMELHSQLTTILLAVASCILVLTTVQLGLHIWKLRQQ
PMWPQETQPLLEVPPPPTEDTSSCQFPEEERGEQLEEKGRRGEQWV
Download sequence
Identical sequences A0A286XXG6
10141.ENSCPOP00000018110 ENSCPOP00000018110 ENSCPOP00000018110 XP_003461601.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]