SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018258 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018258
Domain Number 1 Region: 12-88
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.000000000000738
Family Growth factor receptor domain 0.0029
Further Details:      
 
Domain Number 2 Region: 82-148
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000105
Family VWC domain 0.036
Further Details:      
 
Domain Number 3 Region: 174-221
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000366
Family TSP-1 type 1 repeat 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018258   Gene: ENSCPOG00000023902   Transcript: ENSCPOT00000026954
Sequence length 234
Comment pep:known scaffold:cavPor3:scaffold_45:10756780:10763178:1 gene:ENSCPOG00000023902 transcript:ENSCPOT00000026954 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LSLQVCAQLCPTPCACPWPPPRCPPGVPLVLDGCGCCQVCARRLGEPCDHLHVCDPNQGL
VCQPGDGPGSRRTMCLFGEDDGGCEVNGRRYRDGETFQPHCRLRCRCQDGGLTCLPLCSE
DVRLPSADCPRPRRVELPGKCCPEWVCDQAAELQAPVSSSLGHQFSGVVAPLPPGVPCPE
WSTAWGPCSTTCGLGMTTRVSNQNRFCRLETQHRLCLSRPCPPARGHRPWNGAF
Download sequence
Identical sequences 10141.ENSCPOP00000018258 ENSCPOP00000018258 ENSCPOP00000018258

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]