SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018277 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018277
Domain Number 1 Region: 230-470
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.88e-84
Family Eukaryotic proteases 0.0000000342
Further Details:      
 
Domain Number 2 Region: 48-110
Classification Level Classification E-value
Superfamily GLA-domain 2.75e-25
Family GLA-domain 0.0001
Further Details:      
 
Domain Number 3 Region: 133-180
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000106
Family EGF-type module 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018277   Gene: ENSCPOG00000025563   Transcript: ENSCPOT00000026462
Sequence length 472
Comment pep:known scaffold:cavPor3:scaffold_79:2655342:2666711:-1 gene:ENSCPOG00000025563 transcript:ENSCPOT00000026462 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TQLLNMIMAESWGLITIYLFGYLLNAECTVFLDHENATKILNRPKRFNSGKLEEFIRGNL
ERECLEERCSFEEAREVFENTEKTTEFWKQYVDGDQCESNPCLNGGICKDSIDAYECWCQ
LGFEGRNCELDASCNIKNGRCKQFCKTDAKNKVICSCTEGYQLAEDQKSCEPAVPFPCGR
VSIPSVSKEHNRANAIFSRMGYVNFTDDETIWDDNDDDETIWDNSTESTKPSDEFFRVVG
GEDAKPGQFPWQVLLNGETEAFCGGSIVNEKWIVTAAHCILPGIKIEVVAGKHNIEKKED
TEQRRNVTQIILHHSYNASFNKYSHDIALLELDKPLSLNSYVTPICIANREYTNIFLKFG
AGYVSGWGKLFSQGRTASILQYLRVPLVDRATCLRSTKFTIYNNMFCAGFHEGGRDSCQG
DSGGPHVTEVEGTNFLTGIISWGEECAMKGKYGIYTKVSRYVNWIKQKTKLT
Download sequence
Identical sequences H0VZY3
ENSCPOP00000018277 10141.ENSCPOP00000016267 ENSCPOP00000016267

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]