SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018332 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018332
Domain Number 1 Region: 2-180
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.63e-47
Family L-arabinose binding protein-like 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000018332
Domain Number - Region: 188-221
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0118
Family TNF receptor-like 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018332   Gene: ENSCPOG00000021572   Transcript: ENSCPOT00000026013
Sequence length 222
Comment pep:novel scaffold:cavPor3:scaffold_175:1347485:1349526:1 gene:ENSCPOG00000021572 transcript:ENSCPOT00000026013 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KHHKEICGFQKFIQAVNPSMYPEDNFLTLFWYEHFHCSVADSDCTLENCTPNASLVWLPG
NRFDMTMRDDSYNIYNAVYAVAHTLREMLLEQVQMQSMVHGKGVQISPWQLHRYLKNIQF
NNPTGDQVHLDDKRKLDAEYDILNFWNFPEGLRLKVKVGSFSSHVLHDQQLSLSEDKIEW
ATGITEMPHSVCSESCSPGFRKSTQEGKMACCFDCIPCPENE
Download sequence
Identical sequences 10141.ENSCPOP00000018332 ENSCPOP00000018332 ENSCPOP00000018332

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]