SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018355 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018355
Domain Number 1 Region: 44-97
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000000167
Family TNF receptor-like 0.0029
Further Details:      
 
Domain Number 2 Region: 117-180
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000055
Family TNF receptor-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018355   Gene: ENSCPOG00000020299   Transcript: ENSCPOT00000021185
Sequence length 448
Comment pep:known scaffold:cavPor3:scaffold_25:22286877:22297338:-1 gene:ENSCPOG00000020299 transcript:ENSCPOT00000021185 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSRLSRLAQDLGGSVLGLSCLVFPFQTVFTPPYAPEPSSPCGDRQYYEKTAGMCCSMCQP
GQHLKAFCTKTSDTVCAPCEDSTYTRLWNWASTCLSCGSPCSADQVETQACTPQRNRVCA
CKPGQFCVLGNPDTCRQCMPLRKCLPGFGVVKPGTATSNVHCAPCAPGTFSSTASSTEAC
RPHRNCSSVAIPGNAAMDTVCASVSPTPGVARTPQSVSPRAQPGDPTPRPSAVPSTALLL
PEDLEPPTGKSKNGLSLPIGLIVGLTALGLLLIGLVNCVIVTQRKKKPFCLQREAKVAHV
HVDKIRSVTGLEQQQLLTTAPSSSSSSLESSASAAAPGMEKAEEFGETRTSSRTSDSPPG
ALGTQVNVTCIVNVCSSSEHGSQCPSQASTSMTEDPDASPSSASKDEQVPFSQEERPFQS
LWETPEAPMQSLEKSLPLGVPDQGMKLS
Download sequence
Identical sequences 10141.ENSCPOP00000018355 ENSCPOP00000018355 ENSCPOP00000018355

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]