SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018436 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018436
Domain Number 1 Region: 1-424
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 7.53e-104
Family L-arabinose binding protein-like 0.00066
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000018436
Domain Number - Region: 433-480
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000989
Family TNF receptor-like 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018436   Gene: ENSCPOG00000026305   Transcript: ENSCPOT00000024126
Sequence length 779
Comment pep:known scaffold:cavPor3:scaffold_6:22289366:22298672:1 gene:ENSCPOG00000026305 transcript:ENSCPOT00000024126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FLFAIEQINKNPHLLPNISLGYEFHNFPYSHWKMLESSLIFHTGQSDIPNYSCRRKNKSV
AVLTGTSWAASAQVGTLLELYKFPQVTFGSFDPVLGDNGQFPSIYQAAPKDTSLVLAMVS
LLLHFRWTWVELVIMEGHKGLQFLSDVTGEMDRNKICVAFVKMVSTHLVSYMAAAKEHII
LTKETSQVNVVIIYYDTDFLNDVNHYIEQNLLTEKVWVTNSQWHAGMTGKSFILNSFHGT
LIFSNHREEISDFKMFVQEVNPSKYPDDFYLTRFWFNNFHCSFSDADCSLKDCSPNASLV
QLPASHFDTTMTDWSHNVHNAVYAVAHALHEMLLQQAQMSLMENKKVTVFSPWQLNPILK
NIQFKNPAGDQVNLNDRSKVDVQYDILNFWNFPEGLRLKVKLGTFTPHVPQGQRLSLSDD
MIEWATGITEMPRSVCSESCQHGFRKTSQEGKPACCFDCTPCPENEITNDTEDMEHCVKC
PDDKYATIQKDHCLQKSVTFLAHEDLIGKMLAGTALSLTVLTGAVLGLFVKHQDTPIVKA
NNRALSYTLLISLTFCFLCSLLFIGRPNSATCILQQITFAVVFTVVVSTVLAKTITVVLA
FKITATGRSMRQLLISRAPNYIIPICTLVQLTLCGVWMGTNPPYIDKDAHSEHGHIIILC
NKGSLTAFYCVLGYLGSLALLSFTVAFLARNLPDTFNEAKFLTFSMLMFCSMWLTFLPVY
HSSKGKVMVAMEVFSILVSGAGLLGCIFVPKCYIILLRPERNSLHHFRDKTHSTFVKHS
Download sequence
Identical sequences ENSCPOP00000018436 ENSCPOP00000018436 10141.ENSCPOP00000018436

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]