SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018459 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018459
Domain Number 1 Region: 236-369
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 1.16e-46
Family Regulator of G-protein signaling, RGS 0.00000151
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018459   Gene: ENSCPOG00000025147   Transcript: ENSCPOT00000026344
Sequence length 375
Comment pep:novel scaffold:cavPor3:scaffold_64:3790371:3875362:-1 gene:ENSCPOG00000025147 transcript:ENSCPOT00000026344 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LQEHFSRVSMQKFLPLFRAEGYYANIHQATNKEDPQAMPDVKAAGPAQLPGSPAAPKLRS
LLSSPLCSLAQLFAHLLRRPPPEAPRRRPDFSPLLPALSAARLRRAHEELPGRRLLLLGA
ALALPGRPPGGRPLRPADGVVKPTEEEASAGQSSPMPPMGSECMEMRRRQASASLDAPGD
TATAQPGAGSRGSNACCFCWCCCCSCSCLTVRNQEQRPTRATHELRINFPPCEESPAPTL
EEVSAWARSFDNLMVTPAGRNAFRQFLRTEFSEENMLFWMACEELKKEANKNIIEEKARI
IYEDYISILSPKEVSLDSRVREIINRNMGEPSPHIFDDAQLQIYTLMHRDSYPRFMNSAV
YKDLLQSLSEKSAEA
Download sequence
Identical sequences ENSCPOP00000018459 ENSCPOP00000018459 10141.ENSCPOP00000018459

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]