SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018496 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018496
Domain Number 1 Region: 1-431
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 3.36e-108
Family L-arabinose binding protein-like 0.00053
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000018496
Domain Number - Region: 440-486
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0282
Family TNF receptor-like 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018496   Gene: ENSCPOG00000026120   Transcript: ENSCPOT00000020098
Sequence length 787
Comment pep:known scaffold:cavPor3:scaffold_175:934910:942522:-1 gene:ENSCPOG00000026120 transcript:ENSCPOT00000020098 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NYQNVLAFIFAIEEINKNPCLLPNISLGYEFHNFMHSHWRVLESSLILLTGQDEIPNYTC
RRQSNSIAVLTGTSWATAAQIGTLLELYKFPQLTFGCFDPMLSENAEFSSLYQTAPKDTS
LALGMVSLMLYFGWTWVGLVITEGQKGHQFLSDVKTEMNRNKVRVAFVKMISNAVLSVLA
HAQQHDFLTRETSPVNVGIIYYDTKSLNDVNYNIGQYRMTWTVWITNSQWHADMPGRNFI
LESFHGTLIFAKHHKEIRGFQKFIQAVNPSMYPEDNFLTLFWYDHFHCSVADSDCKLKNC
TPNASLAWLPGNRFDMTMNDDSYNIYNAVYAMAHALHEMLLQQVQRQSMGHREGIQISPW
QLHHYLKNVQVNNPAGDQVNLDNKRKLDAEYDIFNFWNFPEGLRLKVKVGSFSSHVLHNQ
QLSLSEDMIEWATGITETPRSVCSESCNPGFRKSSQEGKMACCFDCTPCPENEIANDTDM
EECVKCPDHQYADIHHKHCVQKSVTFLAYEDSLGRALAGTALSLTILTVAILGLFVKHCS
SPIVKANNRSLSYILLLSLSFCFLCALLFIGRPNTATCILQQVTFGIVFTVAVSTILAKT
ITVVLAFKVTTPDRRIRQFLVSGTPNCIIPICSLIQFTLCGIWMGTSPPFIDRDAHFEHG
FIIIVCNKGSLTAFYCMLGYLGLLALVSFTVAFLARNLPDTFNEAKFITFNMLVFCSVWV
TFLPVYHSTKGRVMVAMEVFSILASSAGLLGCIFAPKCYIILFKKDRCSLQGIKIKIHSG
IFTFLWS
Download sequence
Identical sequences ENSCPOP00000018496 ENSCPOP00000018496 10141.ENSCPOP00000018496

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]