SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018537 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018537
Domain Number 1 Region: 32-106
Classification Level Classification E-value
Superfamily Immunoglobulin 1.75e-22
Family I set domains 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018537   Gene: ENSCPOG00000022675   Transcript: ENSCPOT00000024441
Sequence length 182
Comment pep:known scaffold:cavPor3:scaffold_19:29741597:29750198:-1 gene:ENSCPOG00000022675 transcript:ENSCPOT00000024441 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQGKGLAGLILAVILLQGTKAQKKLEDIKIEVNDKREDGSVLLICNSQDKEITWLKDGN
IINSTNSNKNTWNLGSSSKDPRGIYACQGAKGESKRLQVYYRMCQNCIELSPATISGFLF
VEILSTLFLAVGVYFIAGQDGVRHSRESDKQTLLPNDQLYQPLKDREDDQYSHLQGNHLK
NN
Download sequence
Identical sequences ENSCPOP00000018537 10141.ENSCPOP00000018537 ENSCPOP00000018537

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]