SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018641 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018641
Domain Number 1 Region: 175-402
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.79e-48
Family Ankyrin repeat 0.00025
Further Details:      
 
Domain Number 2 Region: 645-741
Classification Level Classification E-value
Superfamily PDZ domain-like 3.68e-20
Family PDZ domain 0.00000483
Further Details:      
 
Domain Number 3 Region: 528-602
Classification Level Classification E-value
Superfamily SH3-domain 1.44e-18
Family SH3-domain 0.001
Further Details:      
 
Domain Number 4 Region: 1605-1668
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000557
Family SAM (sterile alpha motif) domain 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018641   Gene: ENSCPOG00000025493   Transcript: ENSCPOT00000020380
Sequence length 1672
Comment pep:novel scaffold:cavPor3:scaffold_70:7186577:7226221:1 gene:ENSCPOG00000025493 transcript:ENSCPOT00000020380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTHSPATSEDEERHSVSECPEGGSESDSSPDGPGQGLRGTRGRGSGAPGNLASVRGLQGR
SMSVPDDAHFSMMVFRIGIPDLHQTKCLRFNPDATIWTAKQQVLCALSESLQDVLNYGLF
QPATSGRDANFLEEERLLREYPQSFEKGVPYLEFRYKTRVYKQTNLDEKQLAKLHTKTGL
KKFLEYVQLGTSDKVARLLDKGLDPNYHDSDSGETPLTLAAQTEGSVEVIRTLCLGGAHI
DFRARDGMTALHKAACARHCLALTALLDLGGSPNYKDRRGLTPLFHTAMVGGDPRCCELL
LYNRAQLGISDENGWQEIHQACQRGHSQHLEHLLFYGAEPGAQNASGNTALHICALYNKE
TCARILLYRGANKDVKNNSGQTPFQVAVIAGNFELGELIRNHREQDVVPFQESPKYAARR
RGPPGAGLTVPPALLRANSDTSMALPDWMVFSAPGTSSSAAPGPTSGPQGQSQPSAPTTK
LSSGTLRSASSPRGARARSPSRGRHPEEAKRQPRGRPSSSGTPRDGSLGSRGRRRKLYSA
VPGRSFMAVKSYQAQGEGEISLSKGEKIKVLSIGEGGFWEGQVKGRVGWFPSDCLEEVAN
RSQEGKQESRSDKAKRLFRHYTVGSYDSFDAPSLMDGIGPGSDYIIKEKTVLLQKKDSEG
FGFVLRGAKAQTPIEEFTPTPAFPALQYLESVDEGGVAWRAGLRMGDFLIEVNGQNVVKV
GHRQVVNMIRQGGNTLMVKVVMVTRHPDMDEAVHKKAPQQAKRLPPPAISLRSKSMTSEL
EEMAGLVSPWKKKSEYEQQPAPVPSMEKKRTVYQMALNKLDEILAAAQQTISASESPAPG
GLASLGKHRPKGFFATESSFDPHHRSQPSYERPSFLPPGPGLMLRQKSIGAAEDDRPYLA
PPAMKFSRSLSVPGSEDIPPPPTTSPPEPPYSTPPAPSSSGRLTPSRGGGPFNPGSGGPL
PASSPASFDGPSPPDTRVGTRDKGLYHGGPLPPPPEMETGGAPDDPPPRLALGPQPSLRG
WRGGGPSPGPGAPSPSHHAGGGRYFQLPPRAASAAMYVPARSGRGRKGPLVKQTKVEGEP
HREEGPGIPPPSPRRSVPASPTSPRAEENGLPLLVLPPPAPSVDVDDGDFLFVEPLPPPL
EFSNSFEKPESPLTPAVPAPAAAAPAPPTLDSTASSLTSYDSEVATLTQGAPAAPGDPPD
PPPGTDSGIEEVDSRSSSDHPLETISSASTLSSLSAEGGGSAGGGGRGQRAGATHTWTAR
SFGGSGAPGPSYPPQLMTPKLRGRALGVGGLRPGPAGTPRPCHPTSPTVSVAGAGNDGLL
ALSACSGSSAAGVAGGPVAVEPEVPPVPLPTASSLPRKLLPWEEGPGPPPPPLPGPLSQP
QASALATVKASIISELSSKLQQFGGSSAAGGALPWARGGSGGSGDSHHGGASYVPERTAS
LQRQSRLSDDSQSSSLLSKPVSSLFQNWPKSPLPPLPTGTGVSPSATAAPGAQGVEFEMR
PPLLRRAPSPSLLPASEHKVSPAPRPSSLPILPSGPLYPGLFDIRGSPTGGAGGSADPFA
PVFVPPHATAGMSGGLGGALSGASRSLSPTRLLSLPPDKPFGAKPLGFWTKFDVADWLEW
LGLAEHRARFLDHEIDGSHLPALTKEDYVDLGVTRVGHRMNIDRALKFFLER
Download sequence
Identical sequences ENSCPOP00000018641 ENSCPOP00000018641 10141.ENSCPOP00000018641

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]