SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018742 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018742
Domain Number 1 Region: 123-197
Classification Level Classification E-value
Superfamily DEATH domain 0.0000165
Family DEATH domain, DD 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018742   Gene: ENSCPOG00000026728   Transcript: ENSCPOT00000024278
Sequence length 216
Comment pep:known scaffold:cavPor3:scaffold_16:5275074:5320757:1 gene:ENSCPOG00000026728 transcript:ENSCPOT00000024278 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLRTTKQMGRSTKQPPGGQEDHMAKEPVEDTDPSTLSFNMSDKYPIQDTALPKAEECDT
ITLNCPPNSDEQLQGEENDFPDTIGDPLSGVSKDHPCKEDCACSSCSLRAPTISDLLNDQ
DLLDVIRIKLDPCHPTVKNWRNFASKWGMPYDELCFLEQRPQSPTLEFLLRNSQRPVGQL
MELCHLYHRADVEKVLRRWVEEEWPRRGRADHPDHR
Download sequence
Identical sequences ENSCPOP00000018742 ENSCPOP00000018742 10141.ENSCPOP00000018742

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]