SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018776 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018776
Domain Number 1 Region: 207-283
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.1e-25
Family GAS2 domain 0.00019
Further Details:      
 
Domain Number 2 Region: 21-167
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.45e-25
Family Calponin-homology domain, CH-domain 0.0047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018776   Gene: ENSCPOG00000019765   Transcript: ENSCPOT00000027981
Sequence length 675
Comment pep:known scaffold:cavPor3:scaffold_4:13768364:13772282:-1 gene:ENSCPOG00000019765 transcript:ENSCPOT00000027981 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADPVAGIAGSAAKSVRPFRSSEAYVEAMKEDLAEWLNALYDLGLPGSGDGFLTGLATGT
TLCRHANAVTDAARALAAARPTRGVAFQAHSVAPGSFMARDNVATFIGWCRTELGVPEVL
MFETEDLVLRKNEKSVVLCLLEVARRGARLGLLAPRLVQFEQEIEQELHAAPPVPHVPRA
VEEGTETTTAPAAPARGPRMTPSDLRNLDELVREILGCCTCPDQFPMIKVSEGKYRVGDS
SLLIFVRVLRSHVMVRVGGGWDTLEHYLDKHDPCRCSSTAHRPSQPRARTFSPQRVSPTP
SPRPGSPVPGSEHRGSRQEVTPISLRSTKEGPETPHRPRDQLPPLPRSRRYSGDSDSSAS
SAQSGPLGARSDDSGTGTRRERPSQRLTTASPRRPPPPRSQSRDRLDRGRPRAAQGSRGA
QPSAPSPTRRARSQSREEQAVLLVRRDRDGQHSWMPRGKGGGGSARSTPQASRACSPAAR
RPPRISSPEPELGATPASAFRTPLQLDPQQEQQLFRRLEEEFLANACALEAAASQTPGLA
PDLARAPDPPAPDSAYCSSSSSSSSLSILGGKCGQPGDSGRTANGLPGPRSQALSSSSDE
GSPCLGMGVSLDAPGNPLAGLEPSQSWARGRMDTQPDGKPSRIPTPRGPRRPSEPTQLGA
WHALHSVTSRAKPDS
Download sequence
Identical sequences H0W722
ENSCPOP00000018776 ENSCPOP00000018776 10141.ENSCPOP00000018776 XP_003478388.1.53824

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]