SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018802 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018802
Domain Number 1 Region: 158-293
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 3.14e-28
Family Toll/Interleukin receptor TIR domain 0.0013
Further Details:      
 
Domain Number 2 Region: 6-121
Classification Level Classification E-value
Superfamily DEATH domain 1.3e-25
Family DEATH domain, DD 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018802   Gene: ENSCPOG00000024884   Transcript: ENSCPOT00000027931
Sequence length 295
Comment pep:known scaffold:cavPor3:scaffold_87:2683712:2686208:-1 gene:ENSCPOG00000024884 transcript:ENSCPOT00000027931 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
XSSVPGKDSAPPAVSMSSLPLTALNVRVRRRLSLFLNAKTQVAADWTVLAEEMGFDYLEI
RQLESRLDPTGSLLDAWQGRPGASVGQLLELLAKLDRNDVLLELRSSIEEDCQKYILKQQ
QEESEKPLQVARVDSSVPRTEEPFGITTLDDPLGQAPEYFDAFICYCPSDIQFVQEMIRQ
LEQTDYRLKLCVSDRDVLPGTCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFAL
SLSPGVHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPCTKSWFWTRLAKALSLP
Download sequence
Identical sequences ENSCPOP00000018802 ENSCPOP00000018802 10141.ENSCPOP00000018802

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]