SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Home > Genomes > Cavia porcellus 69_3 > ENSCPOP00000018905

Domain assignment for ENSCPOP00000018905 from Cavia porcellus 69_3

Domain architecture

Domain assignment details

(show help)
Strong hits

Sequence:	ENSCPOP00000018905
Domain Number 1	Region: 6-116
Classification Level	Classification	E-value
Superfamily	Spermadhesin, CUB domain	3.01e-31
Family	Spermadhesin, CUB domain	0.0006
Further Details:

Domain Number 2	Region: 218-329
Classification Level	Classification	E-value
Superfamily	Spermadhesin, CUB domain	5.63e-26
Family	Spermadhesin, CUB domain	0.0015
Further Details:

Domain Number 3	Region: 409-447
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.0000000000131
Family	LDL receptor-like module	0.001
Further Details:

Domain Number 4	Region: 123-159
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000000183
Family	LDL receptor-like module	0.001
Further Details:

Domain Number 5	Region: 370-408
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000103
Family	LDL receptor-like module	0.0021
Further Details:

Domain Number 6	Region: 171-213
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000131
Family	LDL receptor-like module	0.0023
Further Details:

Domain Number 7	Region: 333-370
Classification Level	Classification	E-value
Superfamily	LDL receptor-like module	0.000000589
Family	LDL receptor-like module	0.0025
Further Details:

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by

Molecular Function
Biological Process
Cellular Component

Molecular Function	IC (bits)	H-Score

Biological Process	IC (bits)	H-Score

Cellular Component	IC (bits)	H-Score

Protein sequence

External link(s)	Protein: ENSCPOP00000018905 Gene: ENSCPOG00000024738 Transcript: ENSCPOT00000025359
Sequence length	717
Comment	pep:novel scaffold:cavPor3:scaffold_0:3543194:3561478:1 gene:ENSCPOG00000024738 transcript:ENSCPOT00000025359 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence	GCLPACGETPEQIRAPSGIITSPGWPSEYPARLNCSWLIKANPGEIITISFQDFDVQGSR RCSLDWLTIETFQNVESYRACGSTIPPPYISSQDHVWVRFHSDDSVSRKGFRLAYFSGKS EEPSCACDQFRCGNGKCIPEAWRCNSMDECGDGSDEEVCAREASPPTAASFQPCAYNQFQ CLSRFTKAYTCLPESLKCDGNIDCLDLGDEIDCDVPTCGQWLKYFYGTFNSPNYPDFYPP GSNCTWLIDTGDHRKVIIRFTDFKLDGTGYGDYVKIYDGLEENPHKLLRALTAFDSHAPL TVVSSSGQIRVHFCADKVNAARGFNATYQVDGFCLPWEIPCGGNWGCYTEQQRCDGYWHC PNGRDEINCTMCQKEEFPCSRNGVCYPRSDRCNYQNHCPNGSDEKNCFFCQPGNFHCKNN RCVFESWVCDSQDDCGDGSDEENCPVIVPTRVITAAVIGSLVCGLLLVIALGCTCKLYSL RMFERRSFETQLSRVEAELLRREAPPSYGQLIAQGLIPPVEDFPVCSPNQASVLENLRLA VRSQLGLTSIRLPTAGRSGGLWNRIFSFARSRRSGSLALVSADGDEAVPSPGAGRDAERG PAHRGLFSVESEDRLKPERRDAGGATGGRDGPPXVTQGLRWVRLTQSQSPLRQQEEDQDD DVELLIPAADGADCSRPLLDLVPCERCGMVHTAQVPDACQDVARKGEAGDDEALLLC
Download sequence
Identical sequences	ENSCPOP00000018905 10141.ENSCPOP00000018905 ENSCPOP00000018905

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]