SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018924 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018924
Domain Number 1 Region: 15-214
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 8.04e-48
Family Calponin-homology domain, CH-domain 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018924   Gene: ENSCPOG00000027416   Transcript: ENSCPOT00000022036
Sequence length 217
Comment pep:known scaffold:cavPor3:scaffold_56:9492866:9494547:-1 gene:ENSCPOG00000027416 transcript:ENSCPOT00000022036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QACLCPLPSSPQPPQVFRMANRGPAYGLSREVQQKIEKQYDADLEQILVQWITTQCRKDV
GRPQPGRENFQNWLKDGTVLCELINGLYPEGQAPVKKIQASTMAFKQMEQISQFLQAAER
YGINTTDIFQTVDLWEGKNMACVQRTLMNLGGLAVARDDGFFNGDPNWFPKKSKENPRNF
SDNQLQEGKNVIGLQMGTNRGASQAGMTGYGMPRQIL
Download sequence
Identical sequences 10141.ENSCPOP00000018924 ENSCPOP00000018924 ENSCPOP00000018924

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]