SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000018946 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000018946
Domain Number 1 Region: 34-89
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000013
Family TNF receptor-like 0.0022
Further Details:      
 
Domain Number 2 Region: 89-149
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000162
Family TNF receptor-like 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000018946   Gene: ENSCPOG00000024461   Transcript: ENSCPOT00000022296
Sequence length 172
Comment pep:novel scaffold:cavPor3:scaffold_42:11192933:11196321:1 gene:ENSCPOG00000024461 transcript:ENSCPOT00000022296 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VEESTACCFLVHHRFITLLLDESLPVGYSGPESCNSDEYMNAGHCCKMCPSGQYVEKPCM
RPHTQGVCVKCELGTYTAYANGLESCLLCSTCRADQEVVQKCSPTNDQKCECKQGYFCEN
AGFSEVCTPCDKCPDGTAVLQECNATSNTVCGAAHSGKRVTLLFLTFIDVCI
Download sequence
Identical sequences 10141.ENSCPOP00000018946 ENSCPOP00000018946 ENSCPOP00000018946

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]