SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019001 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019001
Domain Number 1 Region: 14-145
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 1.74e-20
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00088
Further Details:      
 
Domain Number 2 Region: 159-252
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.96e-18
Family Anticodon-binding domain of Class II aaRS 0.0072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019001   Gene: ENSCPOG00000019501   Transcript: ENSCPOT00000022485
Sequence length 258
Comment pep:novel scaffold:cavPor3:scaffold_64:8970136:8970702:1 gene:ENSCPOG00000019501 transcript:ENSCPOT00000022485 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISWKDVRHEMVAKKGLAPEVADRIGDYVQHHGGISLVEQMLQDPRLSQSEQALEGLKPLK
LLFEYLTLFRITEKISFDLSLAQGLDYYMGVIYEAVLPAGEEPLHVGSVAAGGRYDELVA
MFNPKGHKVPCVGLSIGVERIFHIVEQRMKAFGEKVHTTETQVFVATLQKNFLQEQLKLI
AELWDAGIKAEMLYKNNPKLLTQLHYCENTGIPLVVIIGEQEQQEGVIKLWSVATREEEV
IKQEHLVAEIQSKTLEES
Download sequence
Identical sequences ENSCPOP00000019447 10141.ENSCPOP00000019447 ENSCPOP00000019001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]