SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019064 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019064
Domain Number 1 Region: 1-326
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 9.71e-69
Family L-arabinose binding protein-like 0.0000818
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000019064
Domain Number - Region: 340-385
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000361
Family TNF receptor-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019064   Gene: ENSCPOG00000026642   Transcript: ENSCPOT00000020827
Sequence length 671
Comment pep:known scaffold:cavPor3:scaffold_56:64528:70599:-1 gene:ENSCPOG00000026642 transcript:ENSCPOT00000020827 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQVSHSSTLPSLSDKTQFPSFLRTRASDFVSSLAVIQLVLSLGWSWVIILAQDDEFGQQA
GALAARELEKAGICIEFHLTVPSQHSLEKITCVVQKMQTSTATGVLVFLNNSNFRLILQS
LLGFHPLGQVWVSEGLLHTALALATPGISQILQGAFGLLCHNSQVQGFPEFFSSLHPSQI
PEDVFLVRFWEATFGCKWPHENSTETEDVRLCTGAESLRGHEFPFQDVSEVDIAYTAVYS
VAHALQDLVSCEHGSGVCTDLQHLHPWQLLHPLRKVHFQTHDGTDIMFDANGDLVTKFDV
LQGQWNVEGQFQFSHIGTLDPHSSLGNSMMILLKDSVEVPSSVCSTSCEPGFSQIPRQGV
PHYCFECHPCPEGQFADHMKSCLQCPEKQYPSQTRDHCIPRTEIFLTFDEPLGLALTLVS
LALASLACLVFGVFLWFRHTPVVRANNRALSYVLLVSLTLCALSPLLFLGRPSPTTCLLR
QTTFAVVFTVAVSCVLAKTLTVDLAFRATRPGQRVRMCLGNSASSSVVLVSSLMQIILCG
VWLGTSPPFPHRDTASEPGHLVLQCQEGSGMAFSCMLGYLGLLAIGTFSVAFLARDLPDA
FNEAKFLTFSMLLFCSVWTAFLPLYHSARGKATVAVEVFSILASTAGLLGGIFLPKCYLI
LLKPEQNAPTK
Download sequence
Identical sequences ENSCPOP00000019064 ENSCPOP00000019064 10141.ENSCPOP00000019064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]