SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019118 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019118
Domain Number 1 Region: 16-44
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000471
Family BAFF receptor-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019118   Gene: ENSCPOG00000022735   Transcript: ENSCPOT00000024062
Sequence length 176
Comment pep:known scaffold:cavPor3:scaffold_28:25349806:25350911:-1 gene:ENSCPOG00000022735 transcript:ENSCPOT00000024062 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGPGSRSLKGMSGPAPTRCVQTECFDHLVRHCVSCRLLRTPEPRAAGASSQAPGTVLQPQ
ESVGAGTPEAMLPMPGLLFGAPVLLGLALLLALVLVALVSWKWRQRRTQEALEKSQDEPL
DSVYILSSGTPDASAPDWPTPREDPATTPSSHSVPVPATELGSTELVTTKTAGPEQ
Download sequence
Identical sequences ENSCPOP00000019118 ENSCPOP00000019118 10141.ENSCPOP00000019118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]