SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019232 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019232
Domain Number 1 Region: 384-581
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.61e-47
Family Nucleotide and nucleoside kinases 0.00013
Further Details:      
 
Domain Number 2 Region: 202-304
Classification Level Classification E-value
Superfamily SH3-domain 1.72e-22
Family SH3-domain 0.0012
Further Details:      
 
Domain Number 3 Region: 132-217
Classification Level Classification E-value
Superfamily PDZ domain-like 3.81e-20
Family PDZ domain 0.001
Further Details:      
 
Domain Number 4 Region: 67-118
Classification Level Classification E-value
Superfamily L27 domain 0.000000000000188
Family L27 domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019232   Gene: ENSCPOG00000025647   Transcript: ENSCPOT00000024488
Sequence length 585
Comment pep:known scaffold:cavPor3:scaffold_67:9612225:9625239:1 gene:ENSCPOG00000025647 transcript:ENSCPOT00000024488 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVLSEDSGLHETLALLTSQLRPDSSHREEMGFLRGVFSERSLSYLMKIHEKLRCYERQS
PTPVLHSAVALAEDVAEELQAASVHSDQRELLQLLATPHLRAMLMVHDTVAQKNFDPVLP
PLPDNVDEDFEEESVKIVRLVKNKEPLGATIRRDEHTGAVVVARIMRGGAADRSGLVHVG
DELREVNGVTVLHKRPEEISQILAQSQGSITLKIIPATQEGDRFKESKVFMRALFHYDPH
EDRAIPCQEAGLPFQCRQVLEVVSQDDPTWWQAKRLGDTNLRAGLIPSKQFQERRLSYWR
ATGTLPSPPSLRKPPYDQPYDSETCDCDGHFKGHYVAGLRRSFRIGCRKRPGGSQDGKVP
VGSEPLELPTYEEVAQYQPQPGERPRLAVLIGSLGAQLQELKQKLVAENPQRFGVAVPHT
TRPRRSHEKEGVEYHFVSRQVFEADLQHNRFLEHGEYKEHLYGTSLGAVRAVLARNKVCV
VDVEPEALKQLWTSEFKPYVILVKPVVQERRKTPPLSPASEDEAALPDEEQQDVAASAAY
MDQHYGHLADAVLVREDLQGACTQLRALLERLGTDAQWVPVGWVR
Download sequence
Identical sequences H0W8C6
10141.ENSCPOP00000019232 ENSCPOP00000019232 XP_003465797.1.53824 XP_013003639.1.53824 ENSCPOP00000019232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]