SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019410 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019410
Domain Number 1 Region: 35-95
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000000596
Family VWC domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019410   Gene: ENSCPOG00000006836   Transcript: ENSCPOT00000022729
Sequence length 1463
Comment pep:known scaffold:cavPor3:scaffold_3:3195578:3197209:-1 gene:ENSCPOG00000006836 transcript:ENSCPOT00000022729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
HLDMMSFVQKGTWLLLLLLHPTVILAQQTQEVDEGGCTYLGQSYAARDVWKPEPCQICVC
DSGSVLCDDIICDEENLDCPNPEIPFGECCATCPQPSTPAPVPNGRGPQGPKGDPGPPGI
PGRNGDPGIPGQPGPPGAPGAPGICQSCPTGSQNYSPQFDSYDVKSGGPGGLAGYPGPVG
PPGPPGPPGSSGHPGAPGSPGYQGPPGEPGQAGPAGPPGPPGAIGPSGPAGKDGESGRPG
RPGERGLPGPPGMKGPAGMPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGENGSPG
PMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPVPPGPPGTAGFPGSPGAKGEVGPAG
SPGSSGAPGARGEPGPQGHAGAQGPPGPPGSNGSPGGKGEMGPAGIPGAPGLMGARGPAG
PPGTNGAPGQRGSPGEPGKNGAKGDPGARGERGEAGSPGIPGPKGEDGKDGSPGEPGANG
LPGAAGERGAPGFRGPAGPPGLAGEKGPSGERGGPGPAGPRGAAGEPGRDGAPGTPGMRG
APGSPGGPGNDGKPGPPGSQGESGRPGPPGPSGPRGQPGVMGFPGPKGNDGAPGKNGERG
GPGGPGLPGPPGKNGETGPQGPPGPTGASGDKGDPGPPGPQGLQGLPGTAGPPGENGKPG
EAGPKGDVGAPGTPGGKGDAGAPGERGPPGLAGTPGLRGGAGPPGPEGGKGPAGPPGPPG
ASGTPGLQGMPGERGGPGSPGPKGEKGEPGGPGADGAPGKDGPRGPTGPIGPPGPAGQPG
DKGESGAPGLPGIAGPRGGPGERGEHGPPGPAGFPGAPHGNTSEPRAQCTVRVSANRSLY
RPTGTECAGPPGGSGPAGPPGPQGVKGERGSPGGPGASGFPGARGPPGPPGSNGNPGPPG
VSGAPGKDGPPGPPGNNGAPGSPGISGPKGDAGQPGEKGPPGAQGPPGSAGPLGLVGVPG
ARGLAGPPGMPGPRGSPGPQGIKGENGKPGPSGHNGERGPPGPQGLPGLAGAAGEPGRDG
NPGSDGLPGRDGAPGGKGDRGESGHPGPAGPVGPAGKSGDRGETGEGKLSGLPSLAGSQG
APGPQGPRGDKGETGERGSNGIKGHRGFPGNPGPPGSPGPAGHQGAVGSPGPAGPRGPAG
PNGPPGKDGTSGHPGPIGPPGPRGNRGERGSEKMNNDFTKHSCPQPPGPPGAPGPCCGGG
AAIAGFAAGGEKSAPYYGDDPMDLKINTEEIMSSLKSVNGQIESLISPDGSRKNPARNCR
DLKFCHPELKSGEYWVDPNQGCRLDAIKVFCNMETGETCLSASPPSVPLKNWWRDSGAEK
KYVWFGESMDGGFQFSYGNPELPEDVLEVQLAYLRLLSSRASQNITYHCKNSIAYMDQAS
GNVKKALKLMGSNEGEFKAEGSSKFTYTVLEDGCTKHTGEWSKTVFEYRTRKAMRLPIID
IAPYDIGGPDQEFGVDVGPVCFL
Download sequence
Identical sequences ENSCPOP00000006162 ENSCPOP00000019410 10141.ENSCPOP00000006162

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]