SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019610 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019610
Domain Number 1 Region: 191-279
Classification Level Classification E-value
Superfamily DEATH domain 3.2e-17
Family DEATH domain, DD 0.011
Further Details:      
 
Domain Number 2 Region: 32-92
Classification Level Classification E-value
Superfamily TNF receptor-like 0.000000000349
Family TNF receptor-like 0.0025
Further Details:      
 
Domain Number 3 Region: 5-31
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000146
Family TNF receptor-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019610   Gene: ENSCPOG00000021455   Transcript: ENSCPOT00000024078
Sequence length 283
Comment pep:novel scaffold:cavPor3:scaffold_1:59697667:59706497:-1 gene:ENSCPOG00000021455 transcript:ENSCPOT00000024078 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGSYLSDTNTCEDCEDGVDYTTYPNHLQACLPCSSCAQEQIVQHPCTRTSDTVCQCKAGT
FREEGSPEFCQKCRTSCPDGMVIVSPCTPWSDLKCMDKQSDTKYVILAFVILILVGLLVY
FKKTIKLFLQRNILSNCGQDSRTGNFIHLSLLFKHTSNKTKLPFQESAEAEKSPAGRRQL
CPARNVDPTDALRKVFSYCMEYVHHKSWDQFMLHLGLTPNEIHIAKISKPEDPLCEMLHK
WLNKTGRRASINTLLDALENIGEKFAVEHIEDKAVKSKEFIYQ
Download sequence
Identical sequences 10141.ENSCPOP00000019610 ENSCPOP00000019610 ENSCPOP00000019610

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]