SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019617 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019617
Domain Number 1 Region: 32-87
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00000000000338
Family TNF receptor-like 0.0016
Further Details:      
 
Domain Number 2 Region: 86-147
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000000157
Family TNF receptor-like 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019617   Gene: ENSCPOG00000020673   Transcript: ENSCPOT00000026854
Sequence length 170
Comment pep:novel scaffold:cavPor3:scaffold_42:11415295:11419025:-1 gene:ENSCPOG00000020673 transcript:ENSCPOT00000026854 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ESTACCFLVHHHFITLLLDKSLPVGYFGPESCNIDEYMSAGRCCKMCPAGYYVMNSCAKP
HTHGVCGRCEPGTYTAHPNGLQSCRPCSTCQPDQEMVRDCSSVTDRKCECKQGYFSEDAG
FSEFCTPCDKCPHENGVLQKCNATSNTVCTVAHSGKRVCIFFLTPTVFCL
Download sequence
Identical sequences ENSCPOP00000019617 10141.ENSCPOP00000019617 ENSCPOP00000019617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]