SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000019702 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000019702
Domain Number 1 Region: 103-299,465-679,717-749
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 1e-121
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.0000000555
Further Details:      
 
Domain Number 2 Region: 317-465
Classification Level Classification E-value
Superfamily ValRS/IleRS/LeuRS editing domain 8.24e-47
Family ValRS/IleRS/LeuRS editing domain 0.0000322
Further Details:      
 
Domain Number 3 Region: 750-993
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.87e-42
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000019702   Gene: ENSCPOG00000021834   Transcript: ENSCPOT00000026608
Sequence length 1056
Comment pep:novel scaffold:cavPor3:scaffold_15:41714864:41727149:-1 gene:ENSCPOG00000021834 transcript:ENSCPOT00000026608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPHLPLAAFLRRPLRGPRPSRSLPRPQPLSTQSEPHGSPVSRRNREAKQKRLREKQAALQ
AGIAQKSKAGSLTEARKAWSPKEVVLYEIPTEPGEKKDVSGPLPPAYSPRYVEAAWYQWW
VREGFFKPEYQAQLPQATSETFSMCIPPPNVTGSLHLGHALTVAIQDALVRWHRMRGDRV
LWVPGSDHAGIATQAVVEKQLWRERGVRRHELSREEFLRAVWQWKEAKGGEICEQLRALG
SSLDWDRECFTMDAGSSEAVTEAFVRLYNLGLLYRSRQLVNWSCALRSAISDVEVESRAL
SGRTELQLPGCSSPVPFGLLFSVAFPVDGEPDEEVVVGTTRPETLPGDVAVAVHPADSRY
AHLHGRQLCHPLTGQLLPLITDAAVQPHVGTGAVKVTPAHSPADAEMGVRHGLPPISVIA
EDGTMASPCGAWLQGVQRFEAREKIVLALRDRGLFRGLREHPMVLPICSRSGDVVEHLLK
SQWFVRCREMGERAAQAVASGALELHPSFHQKSWQHWFAHIGDWCVSRQLWWGHQIPAYL
VIGEHSKGSGEDCWVVGRSEAEAREAAAALTGRPGAELSLERDPDVLDTWFSSALFPFSA
LGWPRETADLARFYPLSLLETGSDLLLFWVGRMVMLGNQLTGQLPFSKVLLHSMVRDGQG
RKMSKSLGNVLDPRDITHGVELQELQAKLRAGNLDPTELAIATAAQKKDFPHGIPECGTD
ALRFTLCSHGVQGGDLHLSIPEVLSCRRFCNKIWNALRFILNALGENFVPQPPEELCPSS
PMDAWILSCLARATGECERGFLTRELTLVTHTLHHFWLHSLCDVYLESVKPVLSRQVLFS
CADVGLRLLAPLMPFLAEELWQRLPRRPGAPPAPSICVAPYPGAYSLEHWHQPELERRFS
RVQEAVQTLRALRDTYQLTKARPRALLQSSEPEEQGLFQAFLEPLGTLGHCGTVGLLLPG
AAAPSGWAQAPVSDSTRVYMEIQGLVDPEAQLPLLAARRHKLQKQLDGLIAQTPSEGEAE
TQRLQRLSSLRLELSKLEQATLHLQQLMDGSPGPGG
Download sequence
Identical sequences ENSCPOP00000019702 10141.ENSCPOP00000019702 ENSCPOP00000019702

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]