SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSCPOP00000020148 from Cavia porcellus 69_3

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSCPOP00000020148
Domain Number 1 Region: 1-324
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.98e-68
Family L-arabinose binding protein-like 0.0000444
Further Details:      
 
Weak hits

Sequence:  ENSCPOP00000020148
Domain Number - Region: 338-386
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0235
Family TNF receptor-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSCPOP00000020148   Gene: ENSCPOG00000022627   Transcript: ENSCPOT00000022161
Sequence length 669
Comment pep:novel scaffold:cavPor3:scaffold_56:162828:173315:-1 gene:ENSCPOG00000022627 transcript:ENSCPOT00000022161 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PQVSYASSLPTLSDKTQFPSFLRTRPSDLTASYAMTQLVLHLGWSWVGIITQDDFGQQAG
NIASQELGQAGVCIDFHLHVPYHQSPEKIDTIARKMEKSTARGVLVFLTNSIIQLIIQRL
VGIRVLGQVWVSETLLHTVIALATPGASWVLQGAFGLKLHSSHAHGLSEFFAHLHPSRTP
EDMFLRRFWEATFGCRWPHGNYTAPSDMQLCSGNETLRDHKYPFQEVSRLEAAYPAVYSI
AHALQDMVLCEHENSECGDPVHFQPWQLLQPLRKVSFQTPDGTHIMFDANGDLVTKFDVL
QGQWSPEGQFYFVHIGNMYPHPSLENRMMILLKDSIQVPSSVCSTSCEPGSSQIPQQGAP
HCCFECRPCPEGQFADQRDMKSCLQCPDEQYSSQSKDHCLPRTETFLAFDEPLGLVLTVV
SLALASLACLILGVFLWFQKTPVVRANNRALSYVLLVSLSLCALSPLLFLGRPSTTTCLL
RQITFAVVFTVAVSCVLAKTLTVVLAFKATRPGQRVRICLGPFASSSVVLAASLVQIILC
GVWLGTSPPFPHKDTASEPGHLVLQCHEGSGIAFSCVLGYLGLLAIGTFSVAFLARGLPD
TFNETKFLTFSMLLFCSVWTAFLPLYFSARGKATVAVEVFCILASTAGLLGGIFFPKCYL
ILLKPERNT
Download sequence
Identical sequences ENSCPOP00000020148 ENSCPOP00000020148 10141.ENSCPOP00000020148

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]